LXL04_002400 | RubberDandelionOmics

Gene overview

LXL04_002400

Reference: OH-1004 Chr: Chr01 Coordinates: 47946416-47950234 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1575 bp · LXL04_002400|LXL04_002400|OH1004|cDNA

ATGGCGTTATTAGATACGCCTGAGATTGGAACAACGACGACCGCGACGACAACTATACGCGGTGAGTTAAGACGGCGGACGAGCGTAAAGGCCGATGCCGGAACCGACGACGGATTGTTTGATTCTTCGACGTCTTCGAAAACTAGCTCGTTCGAGGATGGTGAGAGTTTGAATAATGGTATTAATGAGAATGGTAAGGAACAGATCGGAGTTGGTGATAAAATGAAAGAGGAGGCGAAGGGAAACGGAGAGAAGGTAGA...

CDS

Download CDS FASTA

1575 bp · LXL04_002400|LXL04_002400|OH1004|CDS

ATGGCGTTATTAGATACGCCTGAGATTGGAACAACGACGACCGCGACGACAACTATACGCGGTGAGTTAAGACGGCGGACGAGCGTAAAGGCCGATGCCGGAACCGACGACGGATTGTTTGATTCTTCGACGTCTTCGAAAACTAGCTCGTTCGAGGATGGTGAGAGTTTGAATAATGGTATTAATGAGAATGGTAAGGAACAGATCGGAGTTGGTGATAAAATGAAAGAGGAGGCGAAGGGAAACGGAGAGAAGGTAGA...

Protein

Download Protein FASTA

524 aa · LXL04_002400|LXL04_002400|OH1004|PROTEIN

MALLDTPEIGTTTTATTTIRGELRRRTSVKADAGTDDGLFDSSTSSKTSSFEDGESLNNGINENGKEQIGVGDKMKEEAKGNGEKVDQGEVKKGGETSVPHYAYRPSSPAHRRIKESPLSSDAIFKQSHAGLFNLCIVVLVAVNGRLIIENLMKYGLLINSNFWFSSRSFRDWPLLMCCLTLPLFPLAAYIVEKLAWQKRISDPIVISLHILTTTTAILYPVFMILSFDSVVLSGVSLMLCACINWLKLVSFVHTNYDMR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002400`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002400

Location Chr01:47946416-47950234 (+)

Description Similar to DGAT1: Diacylglycerol O-acyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19450`	Major contributor to triacylglycerol (TAG) synthesis and oil accumulation in seeds.	The Arabidopsis thaliana TAG1 mutant has a mutation in a diacylglycerol acyltransferase gene.1999 · DOI: 10.1046/j.1365-313x.1999.00555.x The TAG1 locus of Arabidopsis encodes for a diacylglycerol acyltransferase.1999 · DOI: 10.1016/s0981-9428(99)00115-1 Seed-specific over-expression of an Arabidopsis cDNA encoding a diacylglycerol acyltransferase enhances seed oil content and seed weight.2001 · DOI: 10.1104/pp.126.2.861 Arabidopsis mutants deficient in diacylglycerol acyltransferase display increased sensitivity to abscisic acid, sugars, and osmotic stress during germination and seedling development.2002 · DOI: 10.1104/pp.006122 DGAT1 and PDAT1 acyltransferases have overlapping functions in Arabidopsis triacylglycerol biosynthesis and are essential for normal pollen and seed development.2009 · DOI: 10.1105/tpc.109.071795 DGAT1, DGAT2 and PDAT expression in seeds and other tissues of epoxy and hydroxy fatty acid accumulating plants.2010 · DOI: 10.1007/s11745-010-3385-4 AtDGAT2 is a functional acyl-CoA:diacylglycerol acyltransferase and displays different acyl-CoA substrate preferences than AtDGAT1.2013 · DOI: 10.1016/j.febslet.2013.06.003

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002400 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006071 glycerol metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009749 response to glucose Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G19450

gmx:548005

gmx:732606

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.799

Rank 1 · LXL04_002400 · OH-1004

Cell membrane0.080

Rank 2 · LXL04_002400 · OH-1004

Nucleus0.076

Rank 3 · LXL04_002400 · OH-1004

Golgi apparatus0.075

Rank 4 · LXL04_002400 · OH-1004

Cytoplasm0.066

Rank 5 · LXL04_002400 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03062.25MBOAT271-510 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002400	`PF03062.25`	MBOAT	271	510	7.2e-26	92.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLD2`	Arabidopsis thaliana	Diacylglycerol O-acyltransferase 1	62.357%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card