LXL04_002235 | RubberDandelionOmics

Gene overview

LXL04_002235

Reference: OH-1004 Chr: Chr01 Coordinates: 44431116-44434499 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2262 bp · LXL04_002235|LXL04_002235|OH1004|cDNA

ATGGCTTCCAAGATGTCGTCTCGGTCAAGAGGAGGCGCCTCTGTAAAAGCCAATTCCAGAGAAACCGGCCCCAAGCTCGAGGAGAATCTTAACATCTTCAAGTCCGATAAATTCGACGCCGATGCCTTTGTCAACTCCAAGTGTAATTCCTTGAACGAGAAGGAAATAAGACAATTATGCTCATATCTTTTGGATTTAAAGAAAGCTTCTGCAGAGGAAATGCGAAGGAGTGTATACGCTAATTATACTGCATTCATACG...

CDS

Download CDS FASTA

2262 bp · LXL04_002235|LXL04_002235|OH1004|CDS

ATGGCTTCCAAGATGTCGTCTCGGTCAAGAGGAGGCGCCTCTGTAAAAGCCAATTCCAGAGAAACCGGCCCCAAGCTCGAGGAGAATCTTAACATCTTCAAGTCCGATAAATTCGACGCCGATGCCTTTGTCAACTCCAAGTGTAATTCCTTGAACGAGAAGGAAATAAGACAATTATGCTCATATCTTTTGGATTTAAAGAAAGCTTCTGCAGAGGAAATGCGAAGGAGTGTATACGCTAATTATACTGCATTCATACG...

Protein

Download Protein FASTA

753 aa · LXL04_002235|LXL04_002235|OH1004|PROTEIN

MASKMSSRSRGGASVKANSRETGPKLEENLNIFKSDKFDADAFVNSKCNSLNEKEIRQLCSYLLDLKKASAEEMRRSVYANYTAFIRTSKEISDLEGELLSIRNLLSTQATIIHGLADGVHVDSLSITLPEGSGISPDLDRDPSDLETWLIELPDILDVLLAERRVEEALSTLDEGERIASEAKANNSLTPILLSSLQTAITECRQRLANQLSEAASQPTTRGSELRAAITALKKLGDGPHAHTLLLQAHYQRLQSTLQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002235`
TK1151 ID	TkA01G440920
OH-1004 ID	LXL04_002235
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002235

Location Chr01:44431116-44434499 (-)

Description Similar to EXO84B: Exocyst complex component EXO84B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49830`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	The Arabidopsis exocyst complex is involved in cytokinesis and cell plate maturation.2010 · DOI: 10.1105/tpc.110.074351 A Framework for Lateral Membrane Trafficking and Polar Tethering of the PEN3 ATP-Binding Cassette Transporter.2016 · DOI: 10.1104/pp.16.01252
`At1g10385`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release
`At1g10180`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002235 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006887 exocytosis Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0007032 endosome organization Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0015031 protein transport Biological Process

GO:0022617 extracellular matrix disassembly Biological Process

GO:0060321 acceptance of pollen Biological Process

GO:0090148 membrane fission Biological Process

GO:0090522 vesicle tethering involved in exocytosis Biological Process

GO:0000145 exocyst Cellular Component

KEGG gene cross-reference

ath:AT1G10180

ath:AT1G10385

ath:AT5G49830

ddi:DDB_G0279991

mmu:102058

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.564

Rank 1 · LXL04_002235 · OH-1004

Golgi apparatus0.232

Rank 2 · LXL04_002235 · OH-1004

Cell membrane0.219

Rank 3 · LXL04_002235 · OH-1004

Nucleus0.201

Rank 4 · LXL04_002235 · OH-1004

Lysosome / Vacuole0.174

Rank 5 · LXL04_002235 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08700.18VPS51_Exo84_N33-110 aa

PF16528.12Exo84_C149-357 aa

PF27696.1EXO84_helical392-549 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002235	`PF08700.18`	VPS51_Exo84_N	33	110	9.6e-14	52.0
LXL04_002235	`PF16528.12`	Exo84_C	149	357	1.2e-21	78.2
LXL04_002235	`PF27696.1`	EXO84_helical	392	549	1e-55	188.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTB0`	Arabidopsis thaliana	Exocyst complex component EXO84B	70.485%	Swiss-Prot	strong database homology
`F4I4B6`	Arabidopsis thaliana	Exocyst complex component EXO84A	59.577%	Swiss-Prot	strong database homology
`Q9SY60`	Arabidopsis thaliana	Exocyst complex component EXO84C	34.107%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card