LXL04_001682 | RubberDandelionOmics

Gene overview

LXL04_001682

Reference: OH-1004 Chr: Chr01 Coordinates: 31232891-31236743 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · LXL04_001682|LXL04_001682|OH1004|cDNA

ATGGAAACTTTCATGTCCTACACAAAGCTAGCCATTGTATCCATAATTCTAGTGACAACTCTTGTGACTGAACCCATGGCTACAAATGGTCTTCTCATATGTGGGATAAACATCGATGACCTAAAGACCTGCCAACCTGCAGTGACAAAAGATGTGAACCCTCTTCCACCACCAACACCTGATTGTTGTGCTTCCCTAAGTCCCCTAACCGGAGATAATATGCCATGTTTCTGCAACTTAATGGACTCAAGTTTGTTGAA...

CDS

Download CDS FASTA

342 bp · LXL04_001682|LXL04_001682|OH1004|CDS

ATGGAAACTTTCATGTCCTACACAAAGCTAGCCATTGTATCCATAATTCTAGTGACAACTCTTGTGACTGAACCCATGGCTACAAATGGTCTTCTCATATGTGGGATAAACATCGATGACCTAAAGACCTGCCAACCTGCAGTGACAAAAGATGTGAACCCTCTTCCACCACCAACACCTGATTGTTGTGCTTCCCTAAGTCCCCTAACCGGAGATAATATGCCATGTTTCTGCAACTTAATGGACTCAAGTTTGTTGAA...

Protein

Download Protein FASTA

113 aa · LXL04_001682|LXL04_001682|OH1004|PROTEIN

METFMSYTKLAIVSIILVTTLVTEPMATNGLLICGINIDDLKTCQPAVTKDVNPLPPPTPDCCASLSPLTGDNMPCFCNLMDSSLLNIYKIDPILAMELPRKCDLPQANYYHC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001682`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001682

Location Chr01:31232891-31236743 (+)

Description Similar to DIR1: Putative lipid-transfer protein DIR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48485`	Putative lipid transfer protein required for systemic acquired resistance (SAR) long distance signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001682 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0005504 fatty acid binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G48485

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.336

Rank 1 · LXL04_001682 · OH-1004

Cell membrane0.308

Rank 2 · LXL04_001682 · OH-1004

Endoplasmic reticulum0.145

Rank 3 · LXL04_001682 · OH-1004

Cytoplasm0.121

Rank 4 · LXL04_001682 · OH-1004

Lysosome / Vacuole0.069

Rank 5 · LXL04_001682 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368.12LTP_219-113 aa

PF00234.28Tryp_alpha_amyl34-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001682	`PF14368.12`	LTP_2	19	113	9.1e-14	52.1
LXL04_001682	`PF00234.28`	Tryp_alpha_amyl	34	113	6.1e-11	43.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W453`	Arabidopsis thaliana	Putative lipid-transfer protein DIR1	38.158%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card