LXL04_001469 | RubberDandelionOmics

Gene overview

LXL04_001469

Reference: OH-1004 Chr: Chr01 Coordinates: 27318309-27321893 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1785 bp · LXL04_001469|LXL04_001469|OH1004|cDNA

GGGTGTCACGTGTGTAGGCCATATGCTTTACGCCACTATAAAACCTTGCCGAGTTGGTTCAATGTTTTTACCCAACGCTAACATACCACGACTCGAGAGAGccaaagagagagagaaagagacgAAGGGCTCGTCTGCGAGTTCAGAAGGCCTGCAGATTCTTCTTCGACTTTAGCTTACATGGAGCTTGGATTACCGCTGGTGATTCATGACAACTATCATCTTTTTGTTTCCGCCGTTGCATTGCTGTTAGGTTTTGT...

CDS

Download CDS FASTA

1605 bp · LXL04_001469|LXL04_001469|OH1004|CDS

ATGGAGCTTGGATTACCGCTGGTGATTCATGACAACTATCATCTTTTTGTTTCCGCCGTTGCATTGCTGTTAGGTTTTGTTTTGCTGTACGGTTTGAGGTCGAATCTGAAAACGCGTCGTAAATCGAAGGAGATCTGGCGCAAATCTAGTAACAACTCCGGTAACGATGGATTGCAGTTGCCGGAGACTGATGGGAGCACTGACGTCATTATTGTTGGAGCCGGTGTTGCCGGTGCAGCTCTCGCTTGTACTCTTGCAAA...

Protein

Download Protein FASTA

534 aa · LXL04_001469|LXL04_001469|OH1004|PROTEIN

MELGLPLVIHDNYHLFVSAVALLLGFVLLYGLRSNLKTRRKSKEIWRKSSNNSGNDGLQLPETDGSTDVIIVGAGVAGAALACTLAKDGRRVHVIERDLTEPDRIVGELLQPGGYLKLIELGLQDCVDGIEAQQVFGYAIYMDGKNTKLSYPLEKFTSDISGRSFHNGRFIQQMREKAKTLPNLKMEQGTVTSLFEKDGIVNGVCYKTKDGQTLTAHAPLTIVCDGCFSNLRRSLCTPKVDVPSCFVGLVLENIDLPYAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001469`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001469

Location Chr01:27318309-27321893 (-)

Description Similar to SQE1: Squalene monooxygenase SE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58440`	May catalyze stereospecific oxidation of squalene to (S)-2,3-epoxysqualene in sterol biosynthesis.	Arabidopsis thaliana squalene epoxidase 1 is essential for root and seed development.2007 · DOI: 10.1074/jbc.m611831200 Identification of the Arabidopsis dry2/sqe1-5 mutant reveals a central role for sterols in drought tolerance and regulation of reactive oxygen species.2009 · DOI: 10.1111/j.1365-313x.2009.03849.x Analysis of the arabidopsis dry2/sqe1-5 mutant suggests a role for sterols in signaling.2009 · DOI: 10.4161/psb.4.9.9425
`At4g37760`	May catalyze stereospecific oxidation of squalene to (S)-2,3-epoxysqualene in sterol biosynthesis.	Arabidopsis thaliana squalene epoxidase 1 is essential for root and seed development.2007 · DOI: 10.1074/jbc.m611831200
`At2g22830`	Catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, and is considered to be a rate-limiting enzyme in steroid biosynthesis.	Arabidopsis thaliana squalene epoxidase 1 is essential for root and seed development.2007 · DOI: 10.1074/jbc.m611831200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001469 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009725 response to hormone Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010038 response to metal ion Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0046246 terpene biosynthetic process Biological Process

GO:0071731 response to nitric oxide Biological Process

KEGG gene cross-reference

ath:AT1G58440

ath:AT2G22830

ath:AT4G37760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.437

Rank 1 · LXL04_001469 · OH-1004

Mitochondrion0.214

Rank 2 · LXL04_001469 · OH-1004

Cytoplasm0.146

Rank 3 · LXL04_001469 · OH-1004

Cell membrane0.102

Rank 4 · LXL04_001469 · OH-1004

Golgi apparatus0.101

Rank 5 · LXL04_001469 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01494.26FAD_binding_367-377 aa

PF01266.31DAO68-98 aa

PF13450.13NAD_binding_871-97 aa

PF08491.17SE217-490 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001469	`PF01494.26`	FAD_binding_3	67	377	7e-19	69.0
LXL04_001469	`PF01266.31`	DAO	68	98	3.9e-10	40.5
LXL04_001469	`PF13450.13`	NAD_binding_8	71	97	2.4e-06	28.4
LXL04_001469	`PF08491.17`	SE	217	490	9.2e-119	396.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SM02`	Arabidopsis thaliana	Squalene epoxidase 1	73.054%	Swiss-Prot	strong database homology
`Q8VYH2`	Arabidopsis thaliana	Squalene epoxidase 3	72.414%	Swiss-Prot	strong database homology
`O81000`	Arabidopsis thaliana	Squalene epoxidase 2, mitochondrial	71.316%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card