LXL04_000814 | RubberDandelionOmics

Gene overview

LXL04_000814

Reference: OH-1004 Chr: Chr01 Coordinates: 15086483-15087724 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · LXL04_000814|LXL04_000814|OH1004|cDNA

ATGGGGAAGAGAAGAAGTTCGTCCGTGAACACATTATTCTCTTGGGTCCGAAGGCAATCGACGAAGGTGAAGATCTTCTTAGCCATCACGGCTATAATTTCTGCCCTCGCCATTCTAAAAAATTCCGTTCAAAACTACAATAATTTCTTCGTGGCCTCTGAATCCGTTCACGCCGCAGGAATTTTCGTTCTAATTTACAAGCTCAGTACCCTAAAAACGTGTTCAgGCCTTTCGTTACAGACACAAGAGCTCACGGCTAT...

CDS

Download CDS FASTA

819 bp · LXL04_000814|LXL04_000814|OH1004|CDS

ATGGGGAAGAGAAGAAGTTCGTCCGTGAACACATTATTCTCTTGGGTCCGAAGGCAATCGACGAAGGTGAAGATCTTCTTAGCCATCACGGCTATAATTTCTGCCCTCGCCATTCTAAAAAATTCCGTTCAAAACTACAATAATTTCTTCGTGGCCTCTGAATCCGTTCACGCCGCAGGAATTTTCGTTCTAATTTACAAGCTCAGTACCCTAAAAACGTGTTCAGGCCTTTCGTTACAGACACAAGAGCTCACGGCTAT...

Protein

Download Protein FASTA

272 aa · LXL04_000814|LXL04_000814|OH1004|PROTEIN

MGKRRSSSVNTLFSWVRRQSTKVKIFLAITAIISALAILKNSVQNYNNFFVASESVHAAGIFVLIYKLSTLKTCSGLSLQTQELTAIVLAVRISCSSVIGYNVHTILDVAALLATGWVIYMMRFKLYKTYNEHLDKTTKAYLLIPCAFLAIFIHPNSAIPLFSKMKWAFGVYLEAIVVLPQLRMMQRTKMIEPFTAHYVFALGVARFFEAAYWILRVYESTEAYLFLLGRGYFWVPMVLVSEVVQTFILADFCYYYVKSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000814`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000814

Location Chr01:15086483-15087724 (+)

Description Similar to ERD2B: ER lumen protein-retaining receptor B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25040`	Determines the specificity of the luminal endoplasmic reticulum protein retention system.	Specific ER quality control components required for biogenesis of the plant innate immune receptor EFR.2009 · DOI: 10.1073/pnas.0905532106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000814 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006621 protein retention in ER lumen Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0036498 IRE1-mediated unfolded protein response Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0046923 ER retention sequence binding Molecular Function

KEGG gene cross-reference

ath:AT3G25040

cbr:CBG_17162

cel:CELE_C28H8.4

cel:CELE_F09B9.3

ehi:EHI_170470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.529

Rank 1 · LXL04_000814 · OH-1004

Golgi apparatus0.400

Rank 2 · LXL04_000814 · OH-1004

Cytoplasm0.128

Rank 3 · LXL04_000814 · OH-1004

Nucleus0.080

Rank 4 · LXL04_000814 · OH-1004

Cell membrane0.065

Rank 5 · LXL04_000814 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00810.24ER_lumen_recept73-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000814	`PF00810.24`	ER_lumen_recept	73	216	4.7e-41	141.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWI1`	Arabidopsis thaliana	ER lumen protein-retaining receptor B	35.111%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card