LXL04_000674 | RubberDandelionOmics

Gene overview

LXL04_000674

Reference: OH-1004 Chr: Chr01 Coordinates: 12422655-12424652 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · LXL04_000674|LXL04_000674|OH1004|cDNA

ATGGAAGTCACGGTTTCTTATTGTCGCCATCATCAATTCTTATCATCCTACGGAATTGCAATTCAACTTCCGAGGAAGAAACTGATGAGCTTcattcgttgttcctcgccgCAATCCAGTCCTGTTGTAAGGCCTGAGTTGACTATCCGTGTTGGAACTCAACTCATTCCACACCCCAAAAAGGTTGCAAAAGGTGGGGAAGATGCCTTCTTTGTGAGCAGCTACAATGGCGGAGTTATTGCTGTTGCAGATGGTGTTTC...

CDS

Download CDS FASTA

903 bp · LXL04_000674|LXL04_000674|OH1004|CDS

ATGGAAGTCACGGTTTCTTATTGTCGCCATCATCAATTCTTATCATCCTACGGAATTGCAATTCAACTTCCGAGGAAGAAACTGATGAGCTTCATTCGTTGTTCCTCGCCGCAATCCAGTCCTGTTGTAAGGCCTGAGTTGACTATCCGTGTTGGAACTCAACTCATTCCACACCCCAAAAAGGTTGCAAAAGGTGGGGAAGATGCCTTCTTTGTGAGCAGCTACAATGGCGGAGTTATTGCTGTTGCAGATGGTGTTTC...

Protein

Download Protein FASTA

300 aa · LXL04_000674|LXL04_000674|OH1004|PROTEIN

MEVTVSYCRHHQFLSSYGIAIQLPRKKLMSFIRCSSPQSSPVVRPELTIRVGTQLIPHPKKVAKGGEDAFFVSSYNGGVIAVADGVSGWAEKDVDPAQFSRELMRKASSLVEDEEVNYDPRILVRKAHAATSSTGSATVIVSMLDKSGILKIANVGDCGLRVIRKGQIIFSTFPQEHYFDCPYQLSSEAVTQTYLDATVTSVDSVKGDIIVMGSDGLFDNVFDHEILSTIANHQDVVEAAKVLADVAYKHSVDFYFESPY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000674`
TK1151 ID	TkA01G594750
OH-1004 ID	LXL04_000674
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000674

Location Chr01:12422655-12424652 (-)

Description Similar to At2g30170: Probable protein phosphatase 2C 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30170`	Probable protein phosphatase 2C 26.	No verified direct reference in this release
`At5g66720`	Probable protein phosphatase 2C 80.	No verified direct reference in this release
`At4g16580`	Probable protein phosphatase 2C 55.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0164600`	Probable protein phosphatase 2C 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000674 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010027 thylakoid membrane organization Biological Process

GO:0010795 regulation of ubiquinone biosynthetic process Biological Process

GO:0035970 peptidyl-threonine dephosphorylation Biological Process

GO:0071482 cellular response to light stimulus Biological Process

GO:1901525 negative regulation of mitophagy Biological Process

GO:1904775 positive regulation of ubiquinone biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G30170

ath:AT4G16580

ath:AT5G66720

dosa:Os01g0164600

hsa:160760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.900

Rank 1 · LXL04_000674 · OH-1004

Mitochondrion0.069

Rank 2 · LXL04_000674 · OH-1004

Cytoplasm0.064

Rank 3 · LXL04_000674 · OH-1004

Nucleus0.053

Rank 4 · LXL04_000674 · OH-1004

Peroxisome0.040

Rank 5 · LXL04_000674 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64730`	Arabidopsis thaliana	Probable protein phosphatase 2C 26	65.468%	Swiss-Prot	strong database homology
`Q9LVQ8`	Arabidopsis thaliana	Probable protein phosphatase 2C 80	34.572%	Swiss-Prot	moderate database homology
`Q9SUK9`	Arabidopsis thaliana	Probable protein phosphatase 2C 55	36.822%	Swiss-Prot	moderate database homology
`Q942P9`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 1	69.048%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card