Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1473 bp · LXL04_000479|LXL04_000479|OH1004|cDNA
ATGGCATCTAGACTGATTCACAAAGCCACATACGAAGCTGATAACCCGTTTGATGTGTCTCTAAGAGAATCATTCCAACTTCTAGAACCCCAATTAAGGCCTCCATTTCCATTATCAATACCTACAAAACCCGAATACTCAAATCTCAACCATGCTATCTTATACGGCATCCTATGTGAACCTCATTTGGCACAAGTTCATATCAAACACTTACATGGCATCGTAACAGATGGATACTGTTTGTTTACAACTTTACTTAC...
1473 bp · LXL04_000479|LXL04_000479|OH1004|CDS
ATGGCATCTAGACTGATTCACAAAGCCACATACGAAGCTGATAACCCGTTTGATGTGTCTCTAAGAGAATCATTCCAACTTCTAGAACCCCAATTAAGGCCTCCATTTCCATTATCAATACCTACAAAACCCGAATACTCAAATCTCAACCATGCTATCTTATACGGCATCCTATGTGAACCTCATTTGGCACAAGTTCATATCAAACACTTACATGGCATCGTAACAGATGGATACTGTTTGTTTACAACTTTACTTAC...
Protein
Download Protein FASTA490 aa · LXL04_000479|LXL04_000479|OH1004|PROTEIN
MASRLIHKATYEADNPFDVSLRESFQLLEPQLRPPFPLSIPTKPEYSNLNHAILYGILCEPHLAQVHIKHLHGIVTDGYCLFTTLLTKTVNELYSKLIKNVKVQLLLVTSVMIHVSAIGTDGLLVALLRQTHGGDFSESNLWLCLELVNLFLNKWDFFLEEEPLMLSSAMYVFLRLLADHCRVSLSSNSNLQTLKQKEIEFCIRVFREQFHLCLKIGRDLIRLLQDLVHVPEFQQIWKDLLLFPSNFKTLSYSDISQLYQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000479 |
|---|---|
| TK1151 ID | TkA01G609850 |
| OH-1004 ID | LXL04_000479 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000479 |
|---|---|
| Location | Chr01:8670661-8672133 (-) |
| Description | Similar to Ints3: Integrator complex subunit 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006281 DNA repair Biological Process GO:0006974 DNA damage response Biological Process GO:0010212 response to ionizing radiation Biological Process GO:0016180 snRNA processing Biological Process GO:0034243 regulation of transcription elongation by RNA polymerase II Biological Process GO:0044818 mitotic G2/M transition checkpoint Biological Process GO:0160240 RNA polymerase II transcription initiation surveillance Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0032039 integrator complex Cellular Component |
| KEGG gene cross-reference | ddi:DDB_G0268706 hsa:65123 mmu:229543 pon:100171777 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10189.16Ints3_N45-455 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_000479 | PF10189.16 | Ints3_N | 45 | 455 | 6.7e-151 | 503.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.