LXL04_000455 | RubberDandelionOmics

Gene overview

LXL04_000455

Reference: OH-1004 Chr: Chr01 Coordinates: 8416108-8417037 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · LXL04_000455|LXL04_000455|OH1004|cDNA

ATGATGGAAAAGTTTCAAATATTGAGGCGTATTGGGCAAGGATCATACGGGGTTGTCTGGTCTGCATTCGATAAACAAACCGGCGAAGTAGTTGCGATCAAGAAACTGAACACAAAGTGTTACTCAAAGGAAGAGTGCGAAAACCTCATAGAAGTCAAGGCGCTCTTCAAGTTGAAACATCCAAATATCGTAAGACTCAAGGAAGTTGTCTCAATAAAAGGCGGCACGTTGTTTTTGATCTTCGAATGCATGGAAGGCAG...

CDS

Download CDS FASTA

930 bp · LXL04_000455|LXL04_000455|OH1004|CDS

ATGATGGAAAAGTTTCAAATATTGAGGCGTATTGGGCAAGGATCATACGGGGTTGTCTGGTCTGCATTCGATAAACAAACCGGCGAAGTAGTTGCGATCAAGAAACTGAACACAAAGTGTTACTCAAAGGAAGAGTGCGAAAACCTCATAGAAGTCAAGGCGCTCTTCAAGTTGAAACATCCAAATATCGTAAGACTCAAGGAAGTTGTCTCAATAAAAGGCGGCACGTTGTTTTTGATCTTCGAATGCATGGAAGGCAG...

Protein

Download Protein FASTA

309 aa · LXL04_000455|LXL04_000455|OH1004|PROTEIN

MMEKFQILRRIGQGSYGVVWSAFDKQTGEVVAIKKLNTKCYSKEECENLIEVKALFKLKHPNIVRLKEVVSIKGGTLFLIFECMEGSLFQRMNMMFRMQMRFSESEIRNLCFQVFEGLAHMHGNGYFHRDLKPDNLLLSKNVIKIADLGQARETNRKPPYTDYVTTRWYRSPEVLLHSPVHDPAVDMWAMGAIMAELFIGRPLFAGDCAGQVLYKICSVIGSPTESNWSDGIQLARNMNFQFPCFPGVPLATLLPNASNE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000455`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000455

Location Chr01:8416108-8417037 (-)

Description Similar to CDKF-4: Cyclin-dependent kinase F-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13020`	May play a role in the regulation of plant growth and development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0700600`	Cyclin-dependent kinase F-4.	No verified direct reference in this release
`Os03g0847600`	Cyclin-dependent kinase F-3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000455 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0030154 cell differentiation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042073 intraciliary transport Biological Process

GO:0045494 photoreceptor cell maintenance Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0060271 cilium assembly Biological Process

GO:1902856 negative regulation of non-motile cilium assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT4G13020

dosa:Os02g0700600

dosa:Os03g0847600

hsa:4117

rno:25677

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.585

Rank 1 · LXL04_000455 · OH-1004

Nucleus0.577

Rank 2 · LXL04_000455 · OH-1004

Mitochondrion0.055

Rank 3 · LXL04_000455 · OH-1004

Cell membrane0.049

Rank 4 · LXL04_000455 · OH-1004

Endoplasmic reticulum0.031

Rank 5 · LXL04_000455 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase5-288 aa

PF07714.24PK_Tyr_Ser-Thr6-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000455	`PF00069.32`	Pkinase	5	288	1.2e-63	215.7
LXL04_000455	`PF07714.24`	PK_Tyr_Ser-Thr	6	199	4e-30	105.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43294`	Arabidopsis thaliana	Serine/threonine-protein kinase MHK	50.166%	Swiss-Prot	strong database homology
`Q6Z8C8`	Oryza sativa subsp. japonica	Cyclin-dependent kinase F-4	55.631%	Swiss-Prot	strong database homology
`Q84SN3`	Oryza sativa subsp. japonica	Cyclin-dependent kinase F-3	52.083%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card