LXL04_000454 | RubberDandelionOmics

Gene overview

LXL04_000454

Reference: OH-1004 Chr: Chr01 Coordinates: 8407535-8408497 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · LXL04_000454|LXL04_000454|OH1004|cDNA

ATGGATGAATTCGGCGAGGTGGTGACACCAGGGTTCAGATTTTACCCGACAGAAGAAGAATTgataacattttatttaaagCACAAGATTCATGGCACCACCAGGTTATTGCAAGATATTGATCGGATCATACCCGAGCTTCATATTTATGGTTTCGAACCATGGGACCTCTCTCAATATGCTGGAGAACGCTGTCAAGGAGACCTAGAGCAATGGTTCTTTTTCATTCCTAGACAAGAGAAAGAAACAAAAGGAGGGCG...

CDS

Download CDS FASTA

663 bp · LXL04_000454|LXL04_000454|OH1004|CDS

ATGGATGAATTCGGCGAGGTGGTGACACCAGGGTTCAGATTTTACCCGACAGAAGAAGAATTGATAACATTTTATTTAAAGCACAAGATTCATGGCACCACCAGGTTATTGCAAGATATTGATCGGATCATACCCGAGCTTCATATTTATGGTTTCGAACCATGGGACCTCTCTCAATATGCTGGAGAACGCTGTCAAGGAGACCTAGAGCAATGGTTCTTTTTCATTCCTAGACAAGAGAAAGAAACAAAAGGAGGGCG...

Protein

Download Protein FASTA

220 aa · LXL04_000454|LXL04_000454|OH1004|PROTEIN

MDEFGEVVTPGFRFYPTEEELITFYLKHKIHGTTRLLQDIDRIIPELHIYGFEPWDLSQYAGERCQGDLEQWFFFIPRQEKETKGGRPCRLTSSGYWKATGSPSIVYSWNNRAIGVKRTMVFYSGRAPSGTKTKWKMNEYKAFQEDHPFIRTNPGLELMEELSLCRVYVKSNSLRTFDRRPTGVVINGQVGISPGLGTNENHASTSTHPTYPSIHVNELI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000454`
TK1151 ID	TkA01G610910
OH-1004 ID	LXL04_000454
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000454

Location Chr01:8407535-8408497 (+)

Description Similar to NAC090: NAC domain-containing protein 90

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22380`	NAC domain-containing protein 90.	No verified direct reference in this release
`At3g44350`	Putative NAC domain-containing protein 61.	No verified direct reference in this release
`At2g02450`	Transcription factor that acts as a floral repressor.	Control of flowering time and cold response by a NAC-domain protein in Arabidopsis.2007 · DOI: 10.1371/journal.pone.0000642

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000454 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0099402 plant organ development Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G02450

ath:AT5G22380

gmx:732555

sly:543526

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.790

Rank 1 · LXL04_000454 · OH-1004

Cytoplasm0.241

Rank 2 · LXL04_000454 · OH-1004

Cell membrane0.078

Rank 3 · LXL04_000454 · OH-1004

Endoplasmic reticulum0.058

Rank 4 · LXL04_000454 · OH-1004

Plastid0.021

Rank 5 · LXL04_000454 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM10-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000454	`PF02365.21`	NAM	10	141	6.3e-37	127.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMR3`	Arabidopsis thaliana	NAC domain-containing protein 90	55.495%	Swiss-Prot	strong database homology
`Q9M290`	Arabidopsis thaliana	Putative NAC domain-containing protein 61	53.073%	Swiss-Prot	strong database homology
`Q9ZVP8`	Arabidopsis thaliana	NAC domain-containing protein 35	44.311%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card