LXL04_000392 | RubberDandelionOmics

Gene overview

LXL04_000392

Reference: OH-1004 Chr: Chr01 Coordinates: 7322203-7325880 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1644 bp · LXL04_000392|LXL04_000392|OH1004|cDNA

ATGTCGCAAATGGAAGCAGAAAACGGTGATGGCAAGTCGAAGATGGAGGATTATGAGGTTATTGAGCAGATTGGTAGAGGGGCTTTTGGAGCTGCTTTTCTTGTTCTCCATAAGATTGAAAAAAAGAAGTATGTCATGAAGAAGATTCGGTTGAATAAGCAAACAGAGAAGTTTAAGAAGACAGCACATCAAGAGaTGGATTTGATGTCTCGACTTGTTCATCCATATGTTGTGGAGTACAAAGATGCTTGGGTGGATAA...

CDS

Download CDS FASTA

1644 bp · LXL04_000392|LXL04_000392|OH1004|CDS

ATGTCGCAAATGGAAGCAGAAAACGGTGATGGCAAGTCGAAGATGGAGGATTATGAGGTTATTGAGCAGATTGGTAGAGGGGCTTTTGGAGCTGCTTTTCTTGTTCTCCATAAGATTGAAAAAAAGAAGTATGTCATGAAGAAGATTCGGTTGAATAAGCAAACAGAGAAGTTTAAGAAGACAGCACATCAAGAGATGGATTTGATGTCTCGACTTGTTCATCCATATGTTGTGGAGTACAAAGATGCTTGGGTGGATAA...

Protein

Download Protein FASTA

547 aa · LXL04_000392|LXL04_000392|OH1004|PROTEIN

MSQMEAENGDGKSKMEDYEVIEQIGRGAFGAAFLVLHKIEKKKYVMKKIRLNKQTEKFKKTAHQEMDLMSRLVHPYVVEYKDAWVDKVGICIVTAYCEGGDIAELVRKARGAYFPEEKLCKWLTQLLLALDYLHTNRVLHRDLKCSNIFLTKENDVRLGDFGLAKLLNSEDLASSVVGTPNYMCPELLADIPYGYKSDIWSLGCCMFEICAHQQPFRAPRQNNGQTIPQDMSGLINKINRSTISPLPIVYSSTLKQIIKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000392`
TK1151 ID	TkA01G614600
OH-1004 ID	LXL04_000392
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000392

Location Chr01:7322203-7325880 (-)

Description Similar to NEK6: Serine/threonine-protein kinase Nek6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20860`	May be involved in plant development processes.	No verified direct reference in this release
`At3g12200`	May be involved in plant development processes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0590800`	May be involved in plant development processes.	No verified direct reference in this release
`Os05g0440800`	May be involved in plant development processes.	No verified direct reference in this release
`Os01g0864700`	May be involved in plant development processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000392 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010366 negative regulation of ethylene biosynthetic process Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0055028 cortical microtubule Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G12200

ath:AT3G20860

dosa:Os02g0590800

dosa:Os05g0440800

osa:4338922

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.607

Rank 1 · LXL04_000392 · OH-1004

Nucleus0.403

Rank 2 · LXL04_000392 · OH-1004

Cell membrane0.106

Rank 3 · LXL04_000392 · OH-1004

Mitochondrion0.061

Rank 4 · LXL04_000392 · OH-1004

Golgi apparatus0.055

Rank 5 · LXL04_000392 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase18-280 aa

PF07714.24PK_Tyr_Ser-Thr20-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000392	`PF00069.32`	Pkinase	18	280	4.8e-70	236.7
LXL04_000392	`PF07714.24`	PK_Tyr_Ser-Thr	20	277	1.9e-40	139.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT35`	Arabidopsis thaliana	Serine/threonine-protein kinase Nek6	66.254%	Swiss-Prot	moderate database homology
`Q9LHI7`	Arabidopsis thaliana	Serine/threonine-protein kinase Nek7	46.102%	Swiss-Prot	moderate database homology
`Q6YY75`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase Nek6	50.177%	Swiss-Prot	strong database homology
`Q60DG4`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase Nek4	64.646%	Swiss-Prot	moderate database homology
`Q94CU5`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase Nek5	69.343%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card