LXL04_000390 | RubberDandelionOmics

Gene overview

LXL04_000390

Reference: OH-1004 Chr: Chr01 Coordinates: 7277809-7279025 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1008 bp · LXL04_000390|LXL04_000390|OH1004|cDNA

ATGGCGGTTACTTCTTCTCTTATCAAAACACTTATCCTGCTGGTTCTCCTGTTAGCCACCTTCACCACACTAACACTAGGCCAAGGCAATCGGGTTAGTGGCCAGGGTGGCACCCGGGTCGGGTTCTACAGGGCCACATGCCCACGGGCCGAATCAATAGTCCGATCAGCGGTTCGGTCCGCTGTCCAAACCAACCCCACGATTGCACCCGGTTTACTTCGGATGTTCTTCCATGACTGCTTTGTGAATGGTTGTGATGC...

CDS

Download CDS FASTA

1008 bp · LXL04_000390|LXL04_000390|OH1004|CDS

ATGGCGGTTACTTCTTCTCTTATCAAAACACTTATCCTGCTGGTTCTCCTGTTAGCCACCTTCACCACACTAACACTAGGCCAAGGCAATCGGGTTAGTGGCCAGGGTGGCACCCGGGTCGGGTTCTACAGGGCCACATGCCCACGGGCCGAATCAATAGTCCGATCAGCGGTTCGGTCCGCTGTCCAAACCAACCCCACGATTGCACCCGGTTTACTTCGGATGTTCTTCCATGACTGCTTTGTGAATGGTTGTGATGC...

Protein

Download Protein FASTA

335 aa · LXL04_000390|LXL04_000390|OH1004|PROTEIN

MAVTSSLIKTLILLVLLLATFTTLTLGQGNRVSGQGGTRVGFYRATCPRAESIVRSAVRSAVQTNPTIAPGLLRMFFHDCFVNGCDASILIEGGTTEKAAGPNSLLRGFEVIDVAKTELETACPGVVSCADIVALAARDSVVLTGGRSWQVPLGRRDGLVSQASDTANLPAFNDAMNIQIRKFADKGLNVQDLVTLVGAHTIGTSACTLFSYRLYNFNGTNGPDPEINRAFLPQLRAMCPNGGDPLTRVALDTGSEGRFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000390`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000390

Location Chr01:7277809-7279025 (-)

Description Similar to poxN1: Peroxidase N1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64120`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At2g41480`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g39580`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000390 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009808 lignin metabolic process Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0045730 respiratory burst Biological Process

GO:0048511 rhythmic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

KEGG gene cross-reference

ath:AT2G41480

ath:AT5G39580

ath:AT5G64120

nta:107773042

nta:107803841

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.698

Rank 1 · LXL04_000390 · OH-1004

Cytoplasm0.065

Rank 2 · LXL04_000390 · OH-1004

Lysosome / Vacuole0.051

Rank 3 · LXL04_000390 · OH-1004

Cell membrane0.039

Rank 4 · LXL04_000390 · OH-1004

Endoplasmic reticulum0.037

Rank 5 · LXL04_000390 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141.29peroxidase54-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000390	`PF00141.29`	peroxidase	54	293	1.1e-82	278.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q43387`	Arabidopsis thaliana	Peroxidase 71	54.848%	Swiss-Prot	strong database homology
`O80822`	Arabidopsis thaliana	Peroxidase 25	52.294%	Swiss-Prot	strong database homology
`Q9FKA4`	Arabidopsis thaliana	Peroxidase 62	52.121%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card