Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1359 bp · LXL04_000351|LXL04_000351|OH1004|cDNA
ATGGAAAAGGAAGAAGTGGTGGTGTTAGTGGTGCCCTTTGTGCTTCAAGGTCATCTCAATCAACTCCTCCACCTCTCCGGTCTCCTTTCCTCCTATAATCTACCGATCCATATCGTCGTCACAACCACCCACAGCCGTCAAGCAAAGCTTCGTATCCATGGTTGGGATCCCACCTCCGCCACTAATATCCATTTCCATGAATTTAAGACCCCCAATTTCGAGTCACCTCCTCCAGACCCTAATGCTTCCAACAAATTCCC...
1359 bp · LXL04_000351|LXL04_000351|OH1004|CDS
ATGGAAAAGGAAGAAGTGGTGGTGTTAGTGGTGCCCTTTGTGCTTCAAGGTCATCTCAATCAACTCCTCCACCTCTCCGGTCTCCTTTCCTCCTATAATCTACCGATCCATATCGTCGTCACAACCACCCACAGCCGTCAAGCAAAGCTTCGTATCCATGGTTGGGATCCCACCTCCGCCACTAATATCCATTTCCATGAATTTAAGACCCCCAATTTCGAGTCACCTCCTCCAGACCCTAATGCTTCCAACAAATTCCC...
Protein
Download Protein FASTA452 aa · LXL04_000351|LXL04_000351|OH1004|PROTEIN
MEKEEVVVLVVPFVLQGHLNQLLHLSGLLSSYNLPIHIVVTTTHSRQAKLRIHGWDPTSATNIHFHEFKTPNFESPPPDPNASNKFPSHLLPSFQLPSHLREPFAKLLAEIAPTTRRVIIIHDYLMSSVVQDVVSYENAESYVFHGASAFTTFSYIWEANGRPSLDDTESYMQLTKVPALEGIIPPEILESVMCHSICSTFNSGNLHDTCKVFDGKFIDFLSKQGLAGSTNQWAMGPFNPVAIIDNKNLNKRHKSLEWLD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000351 |
|---|---|
| TK1151 ID | TkA01G617700 |
| OH-1004 ID | LXL04_000351 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 96.300 |
| Protein coverage (%) | TK1151 75.472 / OH-1004 71.681Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000351 |
|---|---|
| Location | Chr01:6560585-6561943 (-) |
| Description | Similar to ZOG1: Zeatin O-glucosyltransferase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009101 glycoprotein biosynthetic process Biological Process GO:0009690 cytokinin metabolic process Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0010015 root morphogenesis Biological Process GO:0010083 regulation of vegetative meristem growth Biological Process GO:0010380 regulation of chlorophyll biosynthetic process Biological Process GO:0010817 regulation of hormone levels Biological Process GO:0045926 negative regulation of growth Biological Process GO:0048316 seed development Biological Process GO:0048439 flower morphogenesis Biological Process GO:0080036 regulation of cytokinin-activated signaling pathway Biological Process GO:0035251 UDP-glucosyltransferase activity Molecular Function |
| KEGG gene cross-reference | ag:AAD04166 zma:541881 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF26168.1Glyco_transf_N4-240 aaPF00201.25UDPGT258-387 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_000351 | PF26168.1 | Glyco_transf_N | 4 | 240 | 2.2e-70 | 237.9 |
| LXL04_000351 | PF00201.25 | UDPGT | 258 | 387 | 3.9e-21 | 76.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.