LXL04_000307 | RubberDandelionOmics

Gene overview

LXL04_000307

Reference: OH-1004 Chr: Chr01 Coordinates: 5719748-5721287 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · LXL04_000307|LXL04_000307|OH1004|cDNA

ATGGGTGTATATGGAGAACCATCGAGGAGAGACAAGCCTAGAGGACGCCATCATGGGTTAACTCAGCAGAAAAGGCAAGAGATCAAAGAAGCATTTGAACTCTTTGACACTGATGGCTCTGGCACCATTGATGCCAAGGAGTTGAATGTTGCAATGAGGGCCCTTGGTTTTGAAATGACAGAGGAGCAAATTAATCAAATGATAGCGGATGTAGACAAAGATGGAAGTGGTGCAATtgattttgatgaatttgtGTATAT...

CDS

Download CDS FASTA

507 bp · LXL04_000307|LXL04_000307|OH1004|CDS

ATGGGTGTATATGGAGAACCATCGAGGAGAGACAAGCCTAGAGGACGCCATCATGGGTTAACTCAGCAGAAAAGGCAAGAGATCAAAGAAGCATTTGAACTCTTTGACACTGATGGCTCTGGCACCATTGATGCCAAGGAGTTGAATGTTGCAATGAGGGCCCTTGGTTTTGAAATGACAGAGGAGCAAATTAATCAAATGATAGCGGATGTAGACAAAGATGGAAGTGGTGCAATTGATTTTGATGAATTTGTGTATAT...

Protein

Download Protein FASTA

168 aa · LXL04_000307|LXL04_000307|OH1004|PROTEIN

MGVYGEPSRRDKPRGRHHGLTQQKRQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINQMIADVDKDGSGAIDFDEFVYMMTAKIGERDSKQELTKAFQIIDQDNNGKISFSDIKNIAKELGEHFTDEEINEMVEEADRDHDGEVSVDEFMRMMKRTSYGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000307`
TK1151 ID	TkA01G621310
OH-1004 ID	LXL04_000307
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000307

Location Chr01:5719748-5721287 (+)

Description Similar to Caltractin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50360`	Potential calcium sensor.	No verified direct reference in this release
`At4g37010`	Potential calcium sensor that binds calcium in vitro.	CENTRIN2 interacts with the Arabidopsis homolog of the human XPC protein (AtRAD4) and contributes to efficient synthesis-dependent repair of bulky DNA lesions.2006 · DOI: 10.1007/s11103-006-0016-9

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0618800`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000307 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0006281 DNA repair Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005814 centriole Cellular Component

GO:0005815 microtubule organizing center Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016460 myosin II complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G50360

ath:AT4G37010

dosa:Os07g0618800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · LXL04_000307 · OH-1004

Nucleus0.353

Rank 2 · LXL04_000307 · OH-1004

Cell membrane0.187

Rank 3 · LXL04_000307 · OH-1004

Lysosome / Vacuole0.058

Rank 4 · LXL04_000307 · OH-1004

Endoplasmic reticulum0.052

Rank 5 · LXL04_000307 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21008.4AIF-122-91 aa

PF13499.13EF-hand_726-89 aa

PF00036.39EF-hand_127-55 aa

PF13405.13EF-hand_627-56 aa

PF13202.13EF-hand_528-49 aa

PF14658.13EF-hand_930-91 aa

PF30551.1CFAP251_C40-143 aa

PF13833.13EF-hand_843-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000307	`PF21008.4`	AIF-1	22	91	3e-11	44.4
LXL04_000307	`PF13499.13`	EF-hand_7	26	89	2.6e-36	124.5
LXL04_000307	`PF00036.39`	EF-hand_1	27	55	8.8e-34	113.3
LXL04_000307	`PF13405.13`	EF-hand_6	27	56	7.2e-29	97.4
LXL04_000307	`PF13202.13`	EF-hand_5	28	49	5.9e-22	76.8
LXL04_000307	`PF14658.13`	EF-hand_9	30	91	2.3e-14	54.3
LXL04_000307	`PF30551.1`	CFAP251_C	40	143	1.3e-10	41.9
LXL04_000307	`PF13833.13`	EF-hand_8	43	89	1.7e-25	89.2
LXL04_000307	`PF00036.39`	EF-hand_1	64	90	8.8e-34	113.3
LXL04_000307	`PF13833.13`	EF-hand_8	90	124	1.7e-25	89.2
LXL04_000307	`PF13499.13`	EF-hand_7	99	162	2.6e-36	124.5
LXL04_000307	`PF00036.39`	EF-hand_1	100	127	8.8e-34	113.3
LXL04_000307	`PF13405.13`	EF-hand_6	100	129	7.2e-29	97.4
LXL04_000307	`PF14658.13`	EF-hand_9	104	163	2.3e-14	54.3
LXL04_000307	`PF25325.2`	EF-hand_EFHB_C	118	164	1.2e-07	32.2
LXL04_000307	`PF13833.13`	EF-hand_8	123	163	1.7e-25	89.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82659`	Arabidopsis thaliana	Probable calcium-binding protein CML20	83.030%	Swiss-Prot	strong database homology
`O23184`	Arabidopsis thaliana	Calcium-binding protein CML19	72.436%	Swiss-Prot	strong database homology
`Q7F0J0`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML13	79.630%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card