TkAUNG012170 | RubberDandelionOmics

Gene overview

TkAUNG012170

Reference: TK1151 Chr: ChrUn Coordinates: 2916884-2917491 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · TkAUNG012170|TK1151|cDNA

ATGGTGTCTAAAGGCGAAGATGAAAGAATTGAGGATTGGGAGGGAATAGAGAGAAGTGAATTGGAGAAGAGGTTTGGTAAAGCTGTGGTTTTCGTGAGCTGTAAGACGAATGGTGATGAGATTGATGAAGATGTGAAATCGGAGTTATATGCCCTTCAAAACCTTGTTCTTCAAGGCCCTGCTTCTCTTGCTTCACAACCCTTTCTCTTCAACCTTTCTGCTCGTGCTAACTGGAATGCTTGGCAGAAGCTCGGAAACAT...

CDS

Download CDS FASTA

486 bp · TkAUNG012170|TK1151|CDS

ATGGTGTCTAAAGGCGAAGATGAAAGAATTGAGGATTGGGAGGGAATAGAGAGAAGTGAATTGGAGAAGAGGTTTGGTAAAGCTGTGGTTTTCGTGAGCTGTAAGACGAATGGTGATGAGATTGATGAAGATGTGAAATCGGAGTTATATGCCCTTCAAAACCTTGTTCTTCAAGGCCCTGCTTCTCTTGCTTCACAACCCTTTCTCTTCAACCTTTCTGCTCGTGCTAACTGGAATGCTTGGCAGAAGCTCGGAAACAT...

Protein

Download Protein FASTA

161 aa · TkAUNG012170|TK1151|PROTEIN

MVSKGEDERIEDWEGIERSELEKRFGKAVVFVSCKTNGDEIDEDVKSELYALQNLVLQGPASLASQPFLFNLSARANWNAWQKLGNMSRESAMEKYIDILAKAIPGGRLNIAVEIFCYIWYFILCFIIFNTWTRGGASLRLVGLIFLKFNILCIFFDFFLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012170`
TK1151 ID	TkAUNG012170
OH-1004 ID	LXL04_008013
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.900
Protein coverage (%)	TK1151 65.217 / OH-1004 22.831 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG012170

Location ChrUn:2916884-2917491 (+)

Description Similar to ACBP3: Acyl-CoA-binding domain-containing protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24230`	Binds medium- and long-chain acyl-CoA esters with very high affinity.	Arabidopsis ACBP3 is an extracellularly targeted acyl-CoA-binding protein.2006 · DOI: 10.1007/s00425-005-0139-2
`At4g27780`	Binds medium- and long-chain acyl-CoA esters with very high affinity.	Single amino acid substitutions at the acyl-CoA-binding domain interrupt 14[C]palmitoyl-CoA binding of ACBP2, an Arabidopsis acyl-CoA-binding protein with ankyrin repeats.2000 · DOI: 10.1023/a:1026524108095 ACBP4 and ACBP5, novel Arabidopsis acyl-CoA-binding proteins with kelch motifs that bind oleoyl-CoA.2004 · DOI: 10.1007/s11103-004-0642-z Overexpression of membrane-associated acyl-CoA-binding protein ACBP1 enhances lead tolerance in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03402.x
`At5g53470`	Binds medium- and long-chain acyl-CoA esters with very high affinity.	Arabidopsis ACBP3 is an extracellularly targeted acyl-CoA-binding protein.2006 · DOI: 10.1007/s00425-005-0139-2 Overexpression of membrane-associated acyl-CoA-binding protein ACBP1 enhances lead tolerance in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03402.x Acyl-CoA-Binding Protein ACBP1 Modulates Sterol Synthesis during Embryogenesis.2017 · DOI: 10.1104/pp.17.00412 Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.2018 · DOI: 10.1111/nph.14965

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0243600`	Binds medium- and long-chain acyl-CoA esters with high affinity.	The rice acyl-CoA-binding protein gene family: phylogeny, expression and functional analysis.2011 · DOI: 10.1111/j.1469-8137.2010.03546.x Subcellular localization of rice acyl-CoA-binding proteins (ACBPs) indicates that OsACBP6::GFP is targeted to the peroxisomes.2014 · DOI: 10.1111/nph.12809

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008013 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010162 seed dormancy process Biological Process

GO:0010288 response to lead ion Biological Process

KEGG gene cross-reference

ath:AT4G24230

ath:AT4G27780

ath:AT5G53470

dosa:Os03g0243600

dosa:Os04g0681900

osa:4332223

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.383

Rank 1 · TkAUNG012170 · TK1151

Nucleus0.291

Rank 2 · TkAUNG012170 · TK1151

Endoplasmic reticulum0.145

Rank 3 · TkAUNG012170 · TK1151

Mitochondrion0.137

Rank 4 · TkAUNG012170 · TK1151

Cell membrane0.119

Rank 5 · TkAUNG012170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21825Sequestin17-53 aa

PF00887ACBP22-100 aa

PF15423FLYWCH_N23-69 aa

PF21825Sequestin91-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012170	`PF21825`	Sequestin	17	53	0.0075	16.8
TkAUNG012170	`PF00887`	ACBP	22	100	3.4e-18	66.3
TkAUNG012170	`PF15423`	FLYWCH_N	23	69	0.16	12.8
TkAUNG012170	`PF21825`	Sequestin	91	101	0.0075	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STX1`	Arabidopsis thaliana	sp\|Q9STX1\|ACBP3_ARATH Acyl-CoA-binding domain-containing protein 3	50.500%	Swiss-Prot	Medium
`Q9STP8`	Arabidopsis thaliana	sp\|Q9STP8\|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2	40.200%	Swiss-Prot	Medium
`Q9SM23`	Arabidopsis thaliana	sp\|Q9SM23\|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1	39.400%	Swiss-Prot	Medium
`Q10P83`	Oryza sativa subsp. japonica	sp\|Q10P83\|ACBP5_ORYSJ Acyl-CoA-binding domain-containing protein 5	46.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card