RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G229590
Reference: TK1151 Chr: Chr08 Coordinates: 59843798-59849254 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3118 bp · TkA08G229590|TK1151|cDNA

GTAAGCAGCATAGAATCCGAACCCGGATTTGTTGGCATGAACTAAATCAAATTGTAAACCACCATTCACGTCCGTTTAAACTCGTAATTGAAGGAGGATTATTGCTTTCCGGCTCCGTTTCTCAGTCAAAAAGATAAATAATCGATGAGAGAGAAATATACGTCGGCGGCGTATGGCTCCTGACTTCTAAAATACTCTTAACAGGTCCGATTTTGCCAATCATCACTCTCAATTTTGGCCAATTTGTTGGTTAATTTATC...

CDS

Download CDS FASTA

2559 bp · TkA08G229590|TK1151|CDS

ATGGATTTGGTAGCGAGTTGCAAGGAAAAAATGGCACATTTTCGAATAAGAGAACTGAAGGATATCCTCACTCAACTAGGTCTTTCCAAACAAGGAAAAAAACAGGATCTCACTGACCGTATACTAGCTGTCCTGTCAGATGAAAGAGCAGTTTCAGGAATGTGGTCCAAGAAAAATTCTGTCGGGAAGGAAGGTGTTGCTAAATTAGTTGATGACATTTACAGGAAAATGCAGGATTCAGGGGCAACTGACTTGGCATC...

Protein

Download Protein FASTA

852 aa · TkA08G229590|TK1151|PROTEIN

MDLVASCKEKMAHFRIRELKDILTQLGLSKQGKKQDLTDRILAVLSDERAVSGMWSKKNSVGKEGVAKLVDDIYRKMQDSGATDLASKGRGGVLDGTISATKLKEEIEDVHHMEKVRCPCGNSLQADSMIKCEDPRCNVWQHINCVIIPEKPMEGILPAPPLKFYCELCRLGRADPFWVTVAHPLPPVQLIIANPPTDGTNPVQSVEKTFQLTRADRDLLVKPEYDVQAWCMLLNDKVSFRMQWPLYAELQINGVPMRAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G229590
TK1151 IDTkA08G229590
OH-1004 IDLXL04_033089
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)93.100
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G229590
LocationChr08:59843798-59849254 (-)
DescriptionSimilar to SIZ1: E3 SUMO-protein ligase SIZ1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g60410 E3 SUMO protein ligase involved in regulation processes.
The Arabidopsis SUMO E3 ligase SIZ1 controls phosphate deficiency responses.2005 · DOI: 10.1073/pnas.0500778102
SIZ1 small ubiquitin-like modifier E3 ligase facilitates basal thermotolerance in Arabidopsis independent of salicylic acid.2006 · DOI: 10.1104/pp.106.088831
Salicylic acid-mediated innate immunity in Arabidopsis is regulated by SIZ1 SUMO E3 ligase.2007 · DOI: 10.1111/j.1365-313x.2006.02947.x
SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1A expression and freezing tolerance in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048397
Genetic analysis of SUMOylation in Arabidopsis: conjugation of SUMO1 and SUMO2 to nuclear proteins is essential.2007 · DOI: 10.1104/pp.107.102285
The Arabidopsis E3 SUMO ligase SIZ1 regulates plant growth and drought responses.2007 · DOI: 10.1105/tpc.106.049981
The PHD domain of plant PIAS proteins mediates sumoylation of bromodomain GTE proteins.2008 · DOI: 10.1074/jbc.m708176200
Sumoylation of ABI5 by the Arabidopsis SUMO E3 ligase SIZ1 negatively regulates abscisic acid signaling.2009 · DOI: 10.1073/pnas.0811088106
SUMOylation represses SnRK1 signaling in Arabidopsis.2016 · DOI: 10.1111/tpj.13096

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0125000 Probable SUMO E3 ligase that may regulate Pi starvation responses. No verified direct reference in this release
Os03g0719100 Probable SUMO E3 ligase that may regulate Pi starvation responses. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_033089 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002758 innate immune response-activating signaling pathway Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0006952 defense response Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009553 embryo sac development Biological Process
GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009910 negative regulation of flower development Biological Process
GO:0010113 negative regulation of systemic acquired resistance Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0010247 detection of phosphate ion Biological Process
KEGG gene cross-reference
ath:AT5G60410
dosa:Os03g0719100
dosa:Os05g0125000
hsa:83637
mmu:52915
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942
Rank 1 · TkA08G229590 · TK1151
Cytoplasm0.175
Rank 2 · TkA08G229590 · TK1151
Cell membrane0.025
Rank 3 · TkA08G229590 · TK1151
Mitochondrion0.021
Rank 4 · TkA08G229590 · TK1151
Endoplasmic reticulum0.013
Rank 5 · TkA08G229590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02037SAP13-42 aa
PF09061Stirrup40-79 aa
PF22995C2CH-3rd_BIRD-IDD42-50 aa
PF20826PHD_5111-151 aa
PF13771zf-HC5HC2H112-169 aa
PF11789zf-Nse113-120 aa
PF00628PHD118-169 aa
PF27108PHD_Pygo124-169 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G229590PF02037SAP13422.5e-0627.7
TkA08G229590PF09061Stirrup40790.2312.4
TkA08G229590PF22995C2CH-3rd_BIRD-IDD42500.2711.7
TkA08G229590PF20826PHD_51111510.8210.5
TkA08G229590PF13771zf-HC5HC2H1121690.2912.1
TkA08G229590PF11789zf-Nse1131200.04614.3
TkA08G229590PF00628PHD1181692e-0525.3
TkA08G229590PF27108PHD_Pygo1241690.005517.5
TkA08G229590PF04810zf-Sec23_Sec241641700.04514.5
TkA08G229590PF20826PHD_53293390.8210.5
TkA08G229590PF04641Rtf23574200.0713.2
TkA08G229590PF02891zf-MIZ3634118.3e-2071.0
TkA08G229590PF11789zf-Nse3634090.04614.3
TkA08G229590PF00628PHD3834092e-0525.3
TkA08G229590PF13771zf-HC5HC2H3884120.2912.1
TkA08G229590PF04810zf-Sec23_Sec243944120.04514.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q680Q4Arabidopsis thalianasp|Q680Q4|SIZ1_ARATH E3 SUMO-protein ligase SIZ155.500%Swiss-ProtHigh
Q6L4L4Oryza sativa subsp. japonicasp|Q6L4L4|SIZ1_ORYSJ E3 SUMO-protein ligase SIZ146.700%Swiss-ProtMedium
Q6ASW7Oryza sativa subsp. japonicasp|Q6ASW7|SIZ2_ORYSJ E3 SUMO-protein ligase SIZ255.100%Swiss-ProtHigh

JBrowse

View in Genome Browser