TkA08G212390 | RubberDandelionOmics

Gene overview

TkA08G212390

Reference: TK1151 Chr: Chr08 Coordinates: 55553512-55558424 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2788 bp · TkA08G212390|TK1151|cDNA

GAGTGTAAATATATACAAAAAATTGTACGTACAGAAAAGAGAGAGAAACACACCGATAGCCGCAAGAATTACGAGAATACATCGCTAATTTTACGTGCTTTCATTTTGAATCCCTCTTTACCTAAATTTATCATCGATTTCTCTTCCCTTCGTTCCAAGAAATCCCAAATTGATCAATCAGTTTTTCTACTTTCGTTGCAGAAGGTTTTGATTTTTTTGGAAATTTTTTAGATAAGGTGGAGGAAGAGGTTCACTCGAAC...

CDS

Download CDS FASTA

2121 bp · TkA08G212390|TK1151|CDS

ATGCCACAACTGAGAAGTGGACCACGGAGATCAAAACGTCTTGGAGATAATCAACCTGCTGATCAACCTGAAACCATCGTTGCTCCCACTCAAAACAGAGCAAGAAAGAAAACTGGTGGAGGAAGAGGAAGGGGGGGCGGCGGTGGTGGTGGTGGTAATGCCACAGGTGTAGCAACAAAAACGCCAGTCCGGCCAACTGCTGGTGGTGGTGGTAGAGGCAGAGGCAGAGGCAGAGGCATTAGGTTAATTGACTTAGACCC...

Protein

Download Protein FASTA

706 aa · TkA08G212390|TK1151|PROTEIN

MPQLRSGPRRSKRLGDNQPADQPETIVAPTQNRARKKTGGGRGRGGGGGGGGNATGVATKTPVRPTAGGGGRGRGRGRGIRLIDLDPEQPHCEILPKNKPAIEEPIGVADKEMEGGSADKIMGVEDDGFAAPVPERVQVGSSPIYKTERKLGKGGFGQVYVGRRVSGGSGRTGADAVEVALKFEHRNSKGCNYGPPYEWQVYSTLNGCYGVPWVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSMSPSMVACIAVESIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G212390`
TK1151 ID	TkA08G212390
OH-1004 ID	LXL04_032896
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G212390

Location Chr08:55553512-55558424 (+)

Description Similar to HD16: Casein kinase 1-like protein HD16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0793500`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Hd16, a gene for casein kinase I, is involved in the control of rice flowering time by modulating the day-length response.2013 · DOI: 10.1111/tpj.12268

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032896 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000902 cell morphogenesis Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006897 endocytosis Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007165 signal transduction Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0010507 negative regulation of autophagy Biological Process

GO:0010508 positive regulation of autophagy Biological Process

KEGG gene cross-reference

cel:CELE_C03C10.1

dosa:Os03g0793500

hsa:1452

xla:379624

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.493

Rank 1 · TkA08G212390 · TK1151

Cytoplasm0.447

Rank 2 · TkA08G212390 · TK1151

Cell membrane0.095

Rank 3 · TkA08G212390 · TK1151

Endoplasmic reticulum0.062

Rank 4 · TkA08G212390 · TK1151

Mitochondrion0.057

Rank 5 · TkA08G212390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase145-377 aa

PF07714PK_Tyr_Ser-Thr146-310 aa

PF24289DUF7477194-243 aa

PF03109ABC1240-306 aa

PF14531Kinase-like253-288 aa

PF17667Pkinase_fungal257-355 aa

PF06293Kdo261-299 aa

PF01636APH265-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G212390	`PF00069`	Pkinase	145	377	5.7e-16	59.4
TkA08G212390	`PF07714`	PK_Tyr_Ser-Thr	146	310	1.1e-06	28.8
TkA08G212390	`PF24289`	DUF7477	194	243	1.8e-157	523.1
TkA08G212390	`PF03109`	ABC1	240	306	0.0084	16.0
TkA08G212390	`PF14531`	Kinase-like	253	288	0.23	11.4
TkA08G212390	`PF17667`	Pkinase_fungal	257	355	9.2e-08	31.9
TkA08G212390	`PF06293`	Kdo	261	299	0.0021	18.3
TkA08G212390	`PF01636`	APH	265	301	0.16	12.4
TkA08G212390	`PF19974`	TCAD9	266	297	0.14	12.0
TkA08G212390	`PF19974`	TCAD9	313	349	0.14	12.0
TkA08G212390	`PF24289`	DUF7477	439	705	1.8e-157	523.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q852L0`	Oryza sativa subsp. japonica	sp\|Q852L0\|HD16N_ORYSJ Casein kinase 1-like protein HD16	76.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card