TkA07G423320 | RubberDandelionOmics

Gene overview

TkA07G423320

Reference: TK1151 Chr: Chr07 Coordinates: 107019134-107020530 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1039 bp · TkA07G423320|TK1151|cDNA

ATTTGCCAAAGATCTGCCGGATCTCTGCTTTTAGTCTTTTTGCTTCTTTGAAGCAGATTTTGCCCCCACCCCAACCACCCTATAAATGCCATTTTCTCTCAACTACTTTCATAAAACCGTCATCTTTCCATTTCTATGTACTGTCTCCTGTCCCTCTAGATTCTACAAATCTTTCTCGTTTATCATTCAACATTCATGGAGACCGTGAGCCTCTGTTGCGATCCGATTCCGATCAAATCCCCCGACTCATGTAAAGAGTT...

CDS

Download CDS FASTA

612 bp · TkA07G423320|TK1151|CDS

ATGGAGACCGTGAGCCTCTGTTGCGATCCGATTCCGATCAAATCCCCCGACTCATGTAAAGAGTTGCACGTCCTCGCCGTCGACGACAGCAACGTCGACCGGAAAGTCATCGAGAAGCTTCTCCAGATCTCTTCATTCAAAGTTACAGTTGTTGATAGCGGAAGCAGAGCTTTACAGTATTTAGGGTTAGACGAAGAGAAGAACTCGACTCGATTCGATGATCTGAAGGTGAATTTGATAATGACAGATTATTCCATGCC...

Protein

Download Protein FASTA

203 aa · TkA07G423320|TK1151|PROTEIN

METVSLCCDPIPIKSPDSCKELHVLAVDDSNVDRKVIEKLLQISSFKVTVVDSGSRALQYLGLDEEKNSTRFDDLKVNLIMTDYSMPGMTGFELLKKIKNSSTLREIPVVIMSSENSLTRIDRCLEEGAEDYLLKPVKLSDVRRLKDAILKSGAPEIDQIQTQKRKYELDDQSPKLPTSIDCHDLNLSTSNSPQQSVGKRARL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G423320`
TK1151 ID	TkA07G423320
OH-1004 ID	LXL04_030687
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G423320

Location Chr07:107019134-107020530 (-)

Description Similar to ARR6: Two-component response regulator ARR6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62920`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`At3g48100`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`At1g74890`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	Characterization of the ARR15 and ARR16 response regulators with special reference to the cytokinin signaling pathway mediated by the AHK4 histidine kinase in roots of Arabidopsis thaliana.2002 · DOI: 10.1093/pcp/pcf121 The type-A response regulator, ARR15, acts as a negative regulator in the cytokinin-mediated signal transduction in Arabidopsis thaliana.2003 · DOI: 10.1093/pcp/pcg108
`At1g10470`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	Interaction of the response regulator ARR4 with phytochrome B in modulating red light signaling.2001 · DOI: 10.1126/science.1065022
`At1g19050`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030687 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010114 response to red light Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G10470

ath:AT1G19050

ath:AT1G74890

ath:AT3G48100

ath:AT5G62920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.931

Rank 1 · TkA07G423320 · TK1151

Cytoplasm0.152

Rank 2 · TkA07G423320 · TK1151

Cell membrane0.030

Rank 3 · TkA07G423320 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA07G423320 · TK1151

Plastid0.014

Rank 5 · TkA07G423320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24896Receiver_CRE117-140 aa

PF00072Response_reg24-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G423320	`PF24896`	Receiver_CRE1	17	140	0.14	13.1
TkA07G423320	`PF00072`	Response_reg	24	142	7.5e-22	78.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZWS6`	Arabidopsis thaliana	sp\|Q9ZWS6\|ARR6_ARATH Two-component response regulator ARR6	77.400%	Swiss-Prot	Medium
`Q9SB04`	Arabidopsis thaliana	sp\|Q9SB04\|ARR5_ARATH Two-component response regulator ARR5	71.100%	Swiss-Prot	High
`Q7G8V2`	Arabidopsis thaliana	sp\|Q7G8V2\|ARR15_ARATH Two-component response regulator ARR15	69.700%	Swiss-Prot	Medium
`O82798`	Arabidopsis thaliana	sp\|O82798\|ARR4_ARATH Two-component response regulator ARR4	71.500%	Swiss-Prot	Medium
`Q9ZWS7`	Arabidopsis thaliana	sp\|Q9ZWS7\|ARR7_ARATH Two-component response regulator ARR7	62.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card