TkA07G400160 | RubberDandelionOmics

Gene overview

TkA07G400160

Reference: TK1151 Chr: Chr07 Coordinates: 100556973-100558181 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · TkA07G400160|TK1151|cDNA

ATGCAGACAATTATCTTCATTTTCAAGATCATTATCTTCGTTTTTGTAGTCAGTACAAGTCATGGAGGAATAACTTCCATAATTGATGGAACCCCTCTCAAAGTAATCAAAGATGAACTCGATGGACTAGCCTTCATTGATCAAAGACTCTCAATCATCTACCCGTTGATACAAACCTTCAAGAACACCATCTCCTCCGACCCCCTTAACATCACCGGATCTTGGGTGGGGTCCGATATATGTAGTTACAGAGGCTTTTA...

CDS

Download CDS FASTA

1209 bp · TkA07G400160|TK1151|CDS

ATGCAGACAATTATCTTCATTTTCAAGATCATTATCTTCGTTTTTGTAGTCAGTACAAGTCATGGAGGAATAACTTCCATAATTGATGGAACCCCTCTCAAAGTAATCAAAGATGAACTCGATGGACTAGCCTTCATTGATCAAAGACTCTCAATCATCTACCCGTTGATACAAACCTTCAAGAACACCATCTCCTCCGACCCCCTTAACATCACCGGATCTTGGGTGGGGTCCGATATATGTAGTTACAGAGGCTTTTA...

Protein

Download Protein FASTA

402 aa · TkA07G400160|TK1151|PROTEIN

MQTIIFIFKIIIFVFVVSTSHGGITSIIDGTPLKVIKDELDGLAFIDQRLSIIYPLIQTFKNTISSDPLNITGSWVGSDICSYRGFYCDNPPDNKTATTIASIDFNGFQLTAPSLDGFLDQLPDLALFHANSNFFSGTISPNIANLPYLYELDISNNLFSGSFPNSILGMNTLSFLDIRFNLFTGSIPPQLFTKDLDILFVNNNNFIQKLADVLGNSHILYLTLANNRFYGPIPRTIAKYLSGLSEILLLNNMLSECLPY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G400160`
TK1151 ID	TkA07G400160
OH-1004 ID	LXL04_030372
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G400160

Location Chr07:100556973-100558181 (-)

Description Similar to At4g06744: Uncharacterized protein At4g06744

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g06744`	Uncharacterized protein At4g06744.	No verified direct reference in this release
`At3g24480`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At4g13340`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At2g15880`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At4g33970`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030372 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0005199 structural constituent of cell wall Molecular Function

GO:0042277 peptide binding Molecular Function

KEGG gene cross-reference

ath:AT2G15880

ath:AT3G24480

ath:AT4G06744

ath:AT4G13340

ath:AT4G18670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.440

Rank 1 · TkA07G400160 · TK1151

Endoplasmic reticulum0.105

Rank 2 · TkA07G400160 · TK1151

Lysosome / Vacuole0.103

Rank 3 · TkA07G400160 · TK1151

Extracellular0.098

Rank 4 · TkA07G400160 · TK1151

Cytoplasm0.079

Rank 5 · TkA07G400160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_258-89 aa

PF00560LRR_1129-146 aa

PF12799LRR_4129-158 aa

PF13855LRR_8144-182 aa

PF00560LRR_1149-169 aa

PF00560LRR_1173-191 aa

PF12799LRR_4173-212 aa

PF00560LRR_1196-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G400160	`PF08263`	LRRNT_2	58	89	0.012	16.6
TkA07G400160	`PF00560`	LRR_1	129	146	5.8e-09	35.1
TkA07G400160	`PF12799`	LRR_4	129	158	0.019	15.9
TkA07G400160	`PF13855`	LRR_8	144	182	0.00016	22.1
TkA07G400160	`PF00560`	LRR_1	149	169	5.8e-09	35.1
TkA07G400160	`PF00560`	LRR_1	173	191	5.8e-09	35.1
TkA07G400160	`PF12799`	LRR_4	173	212	0.019	15.9
TkA07G400160	`PF00560`	LRR_1	196	216	5.8e-09	35.1
TkA07G400160	`PF13855`	LRR_8	196	228	0.00016	22.1
TkA07G400160	`PF13855`	LRR_8	196	231	0.00016	22.1
TkA07G400160	`PF00560`	LRR_1	220	238	5.8e-09	35.1
TkA07G400160	`PF13855`	LRR_8	221	276	0.00016	22.1
TkA07G400160	`PF12799`	LRR_4	222	230	0.019	15.9
TkA07G400160	`PF00560`	LRR_1	244	263	5.8e-09	35.1
TkA07G400160	`PF00560`	LRR_1	271	289	5.8e-09	35.1
TkA07G400160	`PF12799`	LRR_4	272	291	0.019	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W3M4`	Arabidopsis thaliana	sp\|Q8W3M4\|Y4744_ARATH Uncharacterized protein At4g06744	57.200%	Swiss-Prot	High
`Q9LHF1`	Arabidopsis thaliana	sp\|Q9LHF1\|LRX4_ARATH Leucine-rich repeat extensin-like protein 4	48.800%	Swiss-Prot	Medium
`Q9T0K5`	Arabidopsis thaliana	sp\|Q9T0K5\|LRX3_ARATH Leucine-rich repeat extensin-like protein 3	47.000%	Swiss-Prot	Medium
`Q9XIL9`	Arabidopsis thaliana	sp\|Q9XIL9\|PLRX3_ARATH Pollen-specific leucine-rich repeat extensin-like protein 3	40.400%	Swiss-Prot	Medium
`O81765`	Arabidopsis thaliana	sp\|O81765\|PLRX4_ARATH Pollen-specific leucine-rich repeat extensin-like protein 4	37.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card