TkA07G304450 | RubberDandelionOmics

Gene overview

TkA07G304450

Reference: TK1151 Chr: Chr07 Coordinates: 76403822-76406092 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · TkA07G304450|TK1151|cDNA

ATGTCCTCTTTCAAGAGAGAGTTTGCGCACCTCAGAATTGCTCTAGAGTCCATACAGATTGCCACCAACAACTTTGCCGAATGCAATGTCCTTGGGGAAGGTGGATATGGTAAAGTTTACAAAGGGAAGTTCTTGAGCTCTCAGGGTCAATGTACCTTCGGTGCTGTAAAGTGCTGGATAAATGTAGATGAAGATCCACAGTTTCAAAGAGAAATCATGTTGCTTTCCGACAATAAACATGAAAATCTCATCTCCCTCGT...

CDS

Download CDS FASTA

477 bp · TkA07G304450|TK1151|CDS

ATGTCCTCTTTCAAGAGAGAGTTTGCGCACCTCAGAATTGCTCTAGAGTCCATACAGATTGCCACCAACAACTTTGCCGAATGCAATGTCCTTGGGGAAGGTGGATATGGTAAAGTTTACAAAGGGAAGTTCTTGAGCTCTCAGGGTCAATGTACCTTCGGTGCTGTAAAGTGCTGGATAAATGTAGATGAAGATCCACAGTTTCAAAGAGAAATCATGTTGCTTTCCGACAATAAACATGAAAATCTCATCTCCCTCGT...

Protein

Download Protein FASTA

158 aa · TkA07G304450|TK1151|PROTEIN

MSSFKREFAHLRIALESIQIATNNFAECNVLGEGGYGKVYKGKFLSSQGQCTFGAVKCWINVDEDPQFQREIMLLSDNKHENLISLVGFCDEEKKKILVYEYAANQSLDFHLEDRTFMWIQRLKACTETAMPMSGNKDSSMFPEWEYNSTSYAEYNWN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G304450`
TK1151 ID	TkA07G304450
OH-1004 ID	LXL04_031976
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	55.700
Protein coverage (%)	TK1151 75.316 / OH-1004 16.349 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G304450

Location Chr07:76403822-76406092 (+)

Description Similar to HERK1: Receptor-like protein kinase HERK 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23200`	Putative cysteine-rich receptor-like protein kinase 12.	No verified direct reference in this release
`At3g24540`	Proline-rich receptor-like protein kinase PERK3.	No verified direct reference in this release
`At5g63710`	Probable LRR receptor-like serine/threonine-protein kinase At5g63710.	No verified direct reference in this release
`At5g61350`	Probable receptor-like protein kinase At5g61350.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031976 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0071395 cellular response to jasmonic acid stimulus Biological Process

GO:0071446 cellular response to salicylic acid stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT2G32800

ath:AT3G46290

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.605

Rank 1 · TkA07G304450 · TK1151

Nucleus0.343

Rank 2 · TkA07G304450 · TK1151

Cell membrane0.152

Rank 3 · TkA07G304450 · TK1151

Endoplasmic reticulum0.069

Rank 4 · TkA07G304450 · TK1151

Mitochondrion0.068

Rank 5 · TkA07G304450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase28-125 aa

PF07714PK_Tyr_Ser-Thr29-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G304450	`PF00069`	Pkinase	28	125	1.9e-11	44.6
TkA07G304450	`PF07714`	PK_Tyr_Ser-Thr	29	133	2.1e-13	50.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65472`	Arabidopsis thaliana	sp\|O65472\|CRK12_ARATH Putative cysteine-rich receptor-like protein kinase 12	41.100%	Swiss-Prot	Medium
`Q1PEM5`	Arabidopsis thaliana	sp\|Q1PEM5\|PERK3_ARATH Proline-rich receptor-like protein kinase PERK3	38.500%	Swiss-Prot	Medium
`Q8W4S5`	Arabidopsis thaliana	sp\|Q8W4S5\|Y5371_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g63710	39.800%	Swiss-Prot	Medium
`Q9FLJ8`	Arabidopsis thaliana	sp\|Q9FLJ8\|Y5613_ARATH Probable receptor-like protein kinase At5g61350	41.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card