TkA07G282260 | RubberDandelionOmics

Gene overview

TkA07G282260

Reference: TK1151 Chr: Chr07 Coordinates: 70623522-70624728 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1005 bp · TkA07G282260|TK1151|cDNA

AATTCTTACGTTAATTCAGTAAGAAAAATAAGAAAAATGAAATTAAAGTGCAAGAAACCCATGACCCCACTTCCCCCCTTTCTCTCTCAAAAACCCAAACTTCTTTGCTTCAAAATCAACTCCCCCATAAATCATTTTCCTGTACAGCTTTAACTGCGTGTGTTGGTGTGTGTGAAGAAGAGGTGTTTGTGAAGCTTGATGATTATGAATAAGTTATAAAATGCCAAATAATCATAGTTATAAGAATGGCGGTGTGAAGA...

CDS

Download CDS FASTA

324 bp · TkA07G282260|TK1151|CDS

ATGCTTTTTAAGGTTCTTGATACGTTCGAGTTTGATGAGGTTCTTACCGAATTTGCATCACAGAAGCGTGTTTATGAAGTTGTGGCGAAGCCTGTTGTGGAGGTTTGCAATACAACTACAAAAGAAACCCCATACCTACAGCATTTTCAATGTGAAATCATCAATATCCGTCACCAAAACAAAAAAAAACGGATTTTTTTCTTCATAATTAAAGTCCAAAAAATTTCTACCCAAAATGCAAAAAATAAAACAATACATTC...

Protein

Download Protein FASTA

107 aa · TkA07G282260|TK1151|PROTEIN

MLFKVLDTFEFDEVLTEFASQKRVYEVVAKPVVEVCNTTTKETPYLQHFQCEIINIRHQNKKKRIFFFIIKVQKISTQNAKNKTIHSKTNLTMSSKLINSMYFVYFT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G282260`
TK1151 ID	TkA07G282260
OH-1004 ID	LXL04_029172
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 28.037 / OH-1004 16.667 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G282260

Location Chr07:70623522-70624728 (-)

Description Similar to KINUA: Kinesin-like protein KIN-UA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12430`	Kinesin-like protein KIN-UA.	No verified direct reference in this release
`At1g01950`	Involved in the control of epidermal-cell morphogenesis in roots and helical growth of roots by promoting microtubule depolymerization and limiting the accumulation of endoplasmic microtubules.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0137100`	Kinesin-like protein KIN-UB.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029172 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0030705 cytoskeleton-dependent intracellular transport Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009574 preprophase band Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

GO:0008574 plus-end-directed microtubule motor activity Molecular Function

KEGG gene cross-reference

ath:AT1G01950

ath:AT1G12430

dosa:Os03g0152900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.362

Rank 1 · TkA07G282260 · TK1151

Mitochondrion0.324

Rank 2 · TkA07G282260 · TK1151

Nucleus0.284

Rank 3 · TkA07G282260 · TK1151

Cell membrane0.058

Rank 4 · TkA07G282260 · TK1151

Extracellular0.034

Rank 5 · TkA07G282260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00225Kinesin8-36 aa

PF31274CglI_C10-99 aa

PF07574SMC_Nse144-101 aa

PF00225Kinesin68-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G282260	`PF00225`	Kinesin	8	36	0.024	14.4
TkA07G282260	`PF31274`	CglI_C	10	99	0.0087	17.1
TkA07G282260	`PF07574`	SMC_Nse1	44	101	0.04	14.5
TkA07G282260	`PF00225`	Kinesin	68	91	0.024	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ06`	Arabidopsis thaliana	sp\|Q9FZ06\|KINUA_ARATH Kinesin-like protein KIN-UA	96.400%	Swiss-Prot	Low
`Q9LPC6`	Arabidopsis thaliana	sp\|Q9LPC6\|KINUB_ARATH Kinesin-like protein KIN-UB	89.300%	Swiss-Prot	Low
`Q5VQ09`	Oryza sativa subsp. japonica	sp\|Q5VQ09\|KINUB_ORYSJ Kinesin-like protein KIN-UB	92.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card