TkA07G025830 | RubberDandelionOmics

Gene overview

TkA07G025830

Reference: TK1151 Chr: Chr07 Coordinates: 6916503-6919507 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1360 bp · TkA07G025830|TK1151|cDNA

TGACTACTCCATGTTCAAAACCAAGAAGCTCTTGATTTTTAGTCCCGGAGCCGGAAAGAAAGTTTGGAGAGAGTAGCCATGGCGGTATCATTTCTTCCATCTTCGACCTTTTCTTCGATTGCAGATTCATTATCATCTAAGAAATTTAGAAGTAGTTCTAAGTTTTATAGTAGTTCATGTTCCGTGTCTCGTGATTCACTCGGTTCTCCTCATCGGCTCCATTCGAGGAGGTCATGTAAGGTCCAAGCAACTGTCTTGCG...

CDS

Download CDS FASTA

1065 bp · TkA07G025830|TK1151|CDS

ATGGCGGTATCATTTCTTCCATCTTCGACCTTTTCTTCGATTGCAGATTCATTATCATCTAAGAAATTTAGAAGTAGTTCTAAGTTTTATAGTAGTTCATGTTCCGTGTCTCGTGATTCACTCGGTTCTCCTCATCGGCTCCATTCGAGGAGGTCATGTAAGGTCCAAGCAACTGTCTTGCGAGAGAATGAAGAGAAAGTGATTGTAGAAGAAACATTTAAACCTAAAACTTCTCCTGAAGAAGAGAATAGAAGTCCCAG...

Protein

Download Protein FASTA

354 aa · TkA07G025830|TK1151|PROTEIN

MAVSFLPSSTFSSIADSLSSKKFRSSSKFYSSSCSVSRDSLGSPHRLHSRRSCKVQATVLRENEEKVIVEETFKPKTSPEEENRSPSEPPNGQPPSSMEKIIIKIEQSINVFLTDSVIKVLDTLYHDRDYPRFFVLETIARVPYFAFMSVLHMYESFGWWRRSEYLKVHFAESWNEMHHLLIMEELGGNAWWFDRFLAQHIAVFYYFMTVFMYILSPRMAYHFSECVEGHAFETYDKFIKAKEDELKNLPPSKVAVKYYT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G025830`
TK1151 ID	TkA07G025830
OH-1004 ID	LXL04_027024
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G025830

Location Chr07:6916503-6919507 (-)

Description Similar to AOX4: Ubiquinol oxidase 4, chloroplastic/chromoplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22260`	Acts early in chloroplast biogenesis as a component of a redox chain responsible for phytoene desaturation.	A plastid terminal oxidase associated with carotenoid desaturation during chromoplast differentiation.2000 · DOI: 10.1104/pp.123.4.1427 Sequences required for the activity of PTOX (IMMUTANS), a plastid terminal oxidase: in vitro and in planta mutagenesis of iron-binding sites and a conserved sequence that corresponds to Exon 8.2005 · DOI: 10.1074/jbc.m508940200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027024 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009266 response to temperature stimulus Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009657 plastid organization Biological Process

GO:0010230 alternative respiration Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT4G22260

ath:AT5G64210

gmx:547897

gmx:548077

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.970

Rank 1 · TkA07G025830 · TK1151

Mitochondrion0.036

Rank 2 · TkA07G025830 · TK1151

Cytoplasm0.020

Rank 3 · TkA07G025830 · TK1151

Nucleus0.020

Rank 4 · TkA07G025830 · TK1151

Cell membrane0.015

Rank 5 · TkA07G025830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01786AOX114-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G025830	`PF01786`	AOX	114	308	3.3e-39	135.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56X52`	Arabidopsis thaliana	sp\|Q56X52\|AOX4_ARATH Ubiquinol oxidase 4, chloroplastic/chromoplastic	75.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card