TkA06G392260 | RubberDandelionOmics

Gene overview

TkA06G392260

Reference: TK1151 Chr: Chr06 Coordinates: 97252811-97257244 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1299 bp · TkA06G392260|TK1151|cDNA

ATGTTAAACAAATCATTTCTCTACAAAGTGTTCGTGGTTAACCCGAAGATTAAATCAAGGAATGTCAACAATTTGTTAATCAAAATTTATTCCGAGAGAGCTCAACCTCAACACCTTGTATGGAGTACAGAGAAGATGATTGACATAAGAGCGATTGGTTCGGAAGGATGGAAAGACAATATGTTAATAAATTACAAATTTGAAGCGGTTAGAGGAAGTCAGAAGAAAATTGTCACCTTTACTTGTGCTGACTTGCCGCT...

CDS

Download CDS FASTA

1299 bp · TkA06G392260|TK1151|CDS

ATGTTAAACAAATCATTTCTCTACAAAGTGTTCGTGGTTAACCCGAAGATTAAATCAAGGAATGTCAACAATTTGTTAATCAAAATTTATTCCGAGAGAGCTCAACCTCAACACCTTGTATGGAGTACAGAGAAGATGATTGACATAAGAGCGATTGGTTCGGAAGGATGGAAAGACAATATGTTAATAAATTACAAATTTGAAGCGGTTAGAGGAAGTCAGAAGAAAATTGTCACCTTTACTTGTGCTGACTTGCCGCT...

Protein

Download Protein FASTA

432 aa · TkA06G392260|TK1151|PROTEIN

MLNKSFLYKVFVVNPKIKSRNVNNLLIKIYSERAQPQHLVWSTEKMIDIRAIGSEGWKDNMLINYKFEAVRGSQKKIVTFTCADLPLMNPFDWLNIFWLLSRKKEPEKYKHYLRHIKLMLKCYITEIAKEDFEVAQKFDRTVEAPNDTADNIDDVRDGSILIDPWSIVYKIHKDGRLQSRIFYMNEKHRYSSFNLNTILAKMEMIMKNKTANKKHITDNIKWWIMVRMFLVGFIGSSFIIKNKGLQRAGASEFYSSIVEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G392260`
TK1151 ID	TkA06G392260
OH-1004 ID	LXL04_008977
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.200
Protein coverage (%)	TK1151 52.546 / OH-1004 57.576 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G392260

Location Chr06:97252811-97257244 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20650`	May be involved in plant defense signaling.	No verified direct reference in this release
`At1g76370`	May be involved in plant defense signaling.	No verified direct reference in this release
`At3g20530`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g18610`	May act as a receptor-like cytoplasmic kinase in chitin-induced immune signaling.	Selective regulation of the chitin-induced defense response by the Arabidopsis receptor-like cytoplasmic kinase PBL27.2014 · DOI: 10.1111/tpj.12535 The Arabidopsis CERK1-associated kinase PBL27 connects chitin perception to MAPK activation.2016 · DOI: 10.15252/embj.201694248
`At3g24790`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008977 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.339

Rank 1 · TkA06G392260 · TK1151

Cytoplasm0.296

Rank 2 · TkA06G392260 · TK1151

Nucleus0.274

Rank 3 · TkA06G392260 · TK1151

Endoplasmic reticulum0.144

Rank 4 · TkA06G392260 · TK1151

Mitochondrion0.075

Rank 5 · TkA06G392260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11166DUF2951128-144 aa

PF11166DUF2951194-240 aa

PF00069Pkinase257-329 aa

PF07714PK_Tyr_Ser-Thr262-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G392260	`PF11166`	DUF2951	128	144	0.081	13.9
TkA06G392260	`PF11166`	DUF2951	194	240	0.081	13.9
TkA06G392260	`PF00069`	Pkinase	257	329	8.2e-09	36.0
TkA06G392260	`PF07714`	PK_Tyr_Ser-Thr	262	330	5.6e-11	42.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDZ5`	Arabidopsis thaliana	sp\|Q9LDZ5\|PBL21_ARATH Probable serine/threonine-protein kinase PBL21	77.800%	Swiss-Prot	Low
`Q9SFX0`	Arabidopsis thaliana	sp\|Q9SFX0\|PBL22_ARATH Probable serine/threonine-protein kinase PBL22	76.200%	Swiss-Prot	Low
`F4JEQ2`	Arabidopsis thaliana	sp\|F4JEQ2\|PBL23_ARATH Probable serine/threonine-protein kinase PBL23	69.100%	Swiss-Prot	Low
`Q1PDV6`	Arabidopsis thaliana	sp\|Q1PDV6\|PBL27_ARATH Serine/threonine-protein kinase PBL27	62.400%	Swiss-Prot	Low
`Q9LRY1`	Arabidopsis thaliana	sp\|Q9LRY1\|PBL25_ARATH Probable serine/threonine-protein kinase PBL25	70.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card