RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G190560
Reference: TK1151 Chr: Chr06 Coordinates: 49715990-49717385 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1186 bp · TkA06G190560|TK1151|cDNA

TATGAATAAAACGTACAGGGGGTAAGTGTAGAAACCATAAAGACTATGGAGAGGATAAAACCGGCCACCCACTGATATCGAACGGATGAGGTAAATATCGAAACGAAATATTCAAACTCCGACACACTCCAGTACGACATGGTGGTTATCACCTCCATCACCACCACAAACACCAGTCTCACACACCACGACTACCGCACACATTATCTACACCCTCACTTGCAAGCCTTCAAGAACCTCTCTTCGTTACTTCCGCCATC...

CDS

Download CDS FASTA

711 bp · TkA06G190560|TK1151|CDS

ATGGTTATTAAGTCTTATATGGAAGACTCCAACACCATCTCCGGCTTCGCCAACAGAGTCATCGGCGCCTTGCCTGTAATCGGCCTCTTGGCCAGAATTCTAACAGACACCGGTGGCGTCGGCGGCGATTTCATTGATTTCGCCGAGTTTCGGAGAAGAGTCGGGAGAAATGCTTCCGTGAATGATTCTAGAGCTTTCGTCGATTTCCAGGATCGAAGAGGACAGGCAGGTGATCCTCTATACGTCTTAATGTGCTGCTG...

Protein

Download Protein FASTA

236 aa · TkA06G190560|TK1151|PROTEIN

MVIKSYMEDSNTISGFANRVIGALPVIGLLARILTDTGGVGGDFIDFAEFRRRVGRNASVNDSRAFVDFQDRRGQAGDPLYVLMCCWLAALGAGLLKSEEILEGVTRLRISNDIEFEEETFIAMMNEARERRAKTKVPAPEIPMVVRAEKALDAIYVCCFGRDGIDEEDERLLRIMLKVVFPSIGQDEINRIVKAKAVRVAEGGEEERYPEPKALSKEAVQLQMKDLQFLQQNNDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G190560
TK1151 IDTkA06G190560
OH-1004 IDLXL04_023990
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 80.546
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G190560
LocationChr06:49715990-49717385 (+)
DescriptionSimilar to PSA3: Photosystem I assembly factor PSA3, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g55250 Nuclear genome-encoded factor required for the accumulation of photosystem I (PSI).
PSA3, a Protein on the Stromal Face of the Thylakoid Membrane, Promotes Photosystem I Accumulation in Cooperation with the Assembly Factor PYG7.2017 · DOI: 10.1104/pp.17.00524

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_023990 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0048564 photosystem I assembly Biological Process
GO:0005634 nucleus Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009535 chloroplast thylakoid membrane Cellular Component
GO:0009570 chloroplast stroma Cellular Component
GO:0009941 chloroplast envelope Cellular Component
GO:0098572 stromal side of plastid thylakoid membrane Cellular Component
KEGG gene cross-reference
ath:AT3G55250
zma:100273037
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.269
Rank 1 · TkA06G190560 · TK1151
Cytoplasm0.268
Rank 2 · TkA06G190560 · TK1151
Nucleus0.235
Rank 3 · TkA06G190560 · TK1151
Mitochondrion0.117
Rank 4 · TkA06G190560 · TK1151
Cell membrane0.102
Rank 5 · TkA06G190560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M3C6Arabidopsis thalianasp|Q9M3C6|PSA3C_ARATH Photosystem I assembly factor PSA3, chloroplastic65.900%Swiss-ProtHigh

JBrowse

View in Genome Browser