TkA06G188120 | RubberDandelionOmics

Gene overview

TkA06G188120

Reference: TK1151 Chr: Chr06 Coordinates: 49113977-49116322 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

720 bp · TkA06G188120|TK1151|cDNA

ATGTGTTTTAGGATGGAGAAAATAGACCTAAGAAATTCAGCTAGTCGAGCAAAATTATTTGGCACGACAGTAGCAATACTGGGAACGATGGTGTTCACATTTTATAAAGGCCCGGAAATTTTCAAGAGTATTATTCCCTCTTTTGATTCACATAATCAACTACTTTTGTCACAACCAGCAGATTGGGTATTTGGAGGTCTAATTCTAGTTATTAGTGCGCTTGTTGCTTCCGTATGGAAGGTTTTACAAGCAGTGACAGC...

CDS

Download CDS FASTA

720 bp · TkA06G188120|TK1151|CDS

ATGTGTTTTAGGATGGAGAAAATAGACCTAAGAAATTCAGCTAGTCGAGCAAAATTATTTGGCACGACAGTAGCAATACTGGGAACGATGGTGTTCACATTTTATAAAGGCCCGGAAATTTTCAAGAGTATTATTCCCTCTTTTGATTCACATAATCAACTACTTTTGTCACAACCAGCAGATTGGGTATTTGGAGGTCTAATTCTAGTTATTAGTGCGCTTGTTGCTTCCGTATGGAAGGTTTTACAAGCAGTGACAGC...

Protein

Download Protein FASTA

239 aa · TkA06G188120|TK1151|PROTEIN

MCFRMEKIDLRNSASRAKLFGTTVAILGTMVFTFYKGPEIFKSIIPSFDSHNQLLLSQPADWVFGGLILVISALVASVWKVLQAVTAREYRDQFTIVFFFCLFGTIQSTVFVLFLERNPNAWVVQPGIGMVAIVFGAVFSTVFRNITWCLRKRDPVFVAMFNPLSIVIASIMGVTFLGDSLHLGSAIGAVIIATGFYSVMLGQANEKKTEVDLGVADERGISQHTAPLLSSTNPNVNFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G188120`
TK1151 ID	TkA06G188120
OH-1004 ID	LXL04_024010
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.400
Protein coverage (%)	TK1151 96.234 / OH-1004 66.495 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G188120

Location Chr06:49113977-49116322 (-)

Description Similar to At3g28050: WAT1-related protein At3g28050

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28130`	WAT1-related protein At3g28130.	No verified direct reference in this release
`At4g15540`	WAT1-related protein At4g15540.	No verified direct reference in this release
`At3g28080`	WAT1-related protein At3g28080.	No verified direct reference in this release
`At3g28100`	WAT1-related protein At3g28100.	No verified direct reference in this release
`At3g28070`	WAT1-related protein At3g28070.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024010 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G28050

ath:AT3G28100

ath:AT5G40210

ath:AT5G40230

ath:AT5G40240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.455

Rank 1 · TkA06G188120 · TK1151

Endoplasmic reticulum0.225

Rank 2 · TkA06G188120 · TK1151

Lysosome / Vacuole0.201

Rank 3 · TkA06G188120 · TK1151

Golgi apparatus0.076

Rank 4 · TkA06G188120 · TK1151

Cytoplasm0.070

Rank 5 · TkA06G188120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA11-33 aa

PF10841DUF264414-31 aa

PF07214DUF141863-87 aa

PF00892EamA65-199 aa

PF10841DUF264467-105 aa

PF07214DUF1418163-188 aa

PF10841DUF2644188-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G188120	`PF00892`	EamA	11	33	5.7e-08	33.9
TkA06G188120	`PF10841`	DUF2644	14	31	9.9	7.2
TkA06G188120	`PF07214`	DUF1418	63	87	0.47	11.0
TkA06G188120	`PF00892`	EamA	65	199	5.7e-08	33.9
TkA06G188120	`PF10841`	DUF2644	67	105	9.9	7.2
TkA06G188120	`PF07214`	DUF1418	163	188	0.47	11.0
TkA06G188120	`PF10841`	DUF2644	188	206	9.9	7.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56X95`	Arabidopsis thaliana	sp\|Q56X95\|WTR23_ARATH WAT1-related protein At3g28130	40.800%	Swiss-Prot	Medium
`F4JK59`	Arabidopsis thaliana	sp\|F4JK59\|WTR33_ARATH WAT1-related protein At4g15540	39.000%	Swiss-Prot	Medium
`F4IYZ0`	Arabidopsis thaliana	sp\|F4IYZ0\|WTR21_ARATH WAT1-related protein At3g28080	37.200%	Swiss-Prot	Medium
`Q9LRS5`	Arabidopsis thaliana	sp\|Q9LRS5\|WTR22_ARATH WAT1-related protein At3g28100	37.400%	Swiss-Prot	Medium
`Q8VYZ7`	Arabidopsis thaliana	sp\|Q8VYZ7\|WTR20_ARATH WAT1-related protein At3g28070	35.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card