TkA06G172770 | RubberDandelionOmics

Gene overview

TkA06G172770

Reference: TK1151 Chr: Chr06 Coordinates: 45370547-45372449 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1243 bp · TkA06G172770|TK1151|cDNA

GATATAAAGCTGTTAGACGTGATAGAAAATAAGAGAGAGATAGGCAACGCAAAGTGTACACAGATCTGTTCGTCCGGCCGTTCCACCGACCTACCGGAGCTCAGCGCCAATAAGAGATCTAGATACAAAGAATAAATACTCTCCGGATCGTTATAATACTTTTGATACAGGGAAAGGCAAGATGATGTCCGGAAATTACACAACCATTGACAACCAGACTGTTTCTGGATCTGTTCCTGCTGTTTCAGATCCTCCAGGAC...

CDS

Download CDS FASTA

846 bp · TkA06G172770|TK1151|CDS

ATGATGTCCGGAAATTACACAACCATTGACAACCAGACTGTTTCTGGATCTGTTCCTGCTGTTTCAGATCCTCCAGGACAAGTGTCTGTGAAATTTAATGATTCAACTCTCCAAACCTTTCCCCCATCTGGAACACAAGGAAAGATCTCAGGCGCTTCTGGACCGCCCCGTGATGCCGATGATTCATTCTCAAAGCCAGTATCCGGTTCATCAGAACCACAACAAAGCACCGGTTGGTTCAAAATATTCACAGTTGCTGC...

Protein

Download Protein FASTA

281 aa · TkA06G172770|TK1151|PROTEIN

MMSGNYTTIDNQTVSGSVPAVSDPPGQVSVKFNDSTLQTFPPSGTQGKISGASGPPRDADDSFSKPVSGSSEPQQSTGWFKIFTVAAYQPYFDVDTSDVLERIKDSLIPFGGSFNEKTANNPDLYGPFWICTTLIFVAASIGTFVTYLAHKLQHKEWNYDINLVTWSAGVFYGYVLVVPLCLYIILKYFSAPSGLVQLFCLYGYSLFIFIPAMCLSVVPMEIFRWVITGVAGVMSALFVSLNLRNHIMAAGERWFLIVAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G172770`
TK1151 ID	TkA06G172770
OH-1004 ID	LXL04_021902
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	39.400
Protein coverage (%)	TK1151 98.932 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G172770`
Location	Chr06:45370547-45372449 (-)
Description	Similar to yipf1: Protein YIPF1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021902` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016192 vesicle-mediated transport Biological Process GO:0000138 Golgi trans cisterna Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005797 Golgi medial cisterna Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0005886 plasma membrane Cellular Component GO:0030133 transport vesicle Cellular Component GO:0031902 late endosome membrane Cellular Component GO:0031267 small GTPase binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0281587 hsa:54432 mmu:230584 pon:100172394 rno:298312 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.637

Rank 1 · TkA06G172770 · TK1151

Endoplasmic reticulum0.242

Rank 2 · TkA06G172770 · TK1151

Cytoplasm0.242

Rank 3 · TkA06G172770 · TK1151

Cell membrane0.103

Rank 4 · TkA06G172770 · TK1151

Lysosome / Vacuole0.068

Rank 5 · TkA06G172770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03878YIF186-249 aa

PF29331YIPF3_C98-268 aa

PF04893Yip1113-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G172770	`PF03878`	YIF1	86	249	0.01	16.0
TkA06G172770	`PF29331`	YIPF3_C	98	268	2e-05	25.2
TkA06G172770	`PF04893`	Yip1	113	270	2.8e-15	57.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card