TkA06G165250 | RubberDandelionOmics

Gene overview

TkA06G165250

Reference: TK1151 Chr: Chr06 Coordinates: 43541846-43542660 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

653 bp · TkA06G165250|TK1151|cDNA

TTCCAGGATCTTGATATTAGTGAGGATGGTGAGAGTTAGTGTTCTGAATGACGCTCTTAAGAGCATGTACAATGCGGTGAAGAGAGGCAAAAGACAGGTCATGATTAGGCCATCTTCAAAAGTTATCTTCAAGTTTCTCATGGTTATGCAAAAACATGGTTATATTGGTGAGTTTGAGTATGTTGATGACCATAGATCCGGTAAGATTGTGGTGGAATTGAATGGAAGAATGAACAAATGTGGAGTTATCAGTCCTCGAT...

CDS

Download CDS FASTA

393 bp · TkA06G165250|TK1151|CDS

ATGGTGAGAGTTAGTGTTCTGAATGACGCTCTTAAGAGCATGTACAATGCGGTGAAGAGAGGCAAAAGACAGGTCATGATTAGGCCATCTTCAAAAGTTATCTTCAAGTTTCTCATGGTTATGCAAAAACATGGTTATATTGGTGAGTTTGAGTATGTTGATGACCATAGATCCGGTAAGATTGTGGTGGAATTGAATGGAAGAATGAACAAATGTGGAGTTATCAGTCCTCGATTTGATGTCGGTGTTAAGGAAATTGA...

Protein

Download Protein FASTA

130 aa · TkA06G165250|TK1151|PROTEIN

MVRVSVLNDALKSMYNAVKRGKRQVMIRPSSKVIFKFLMVMQKHGYIGEFEYVDDHRSGKIVVELNGRMNKCGVISPRFDVGVKEIEPWTARLLPSRQFGHIVLTTSAGIMDHEEARRKNVGGKVLGFFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G165250`
TK1151 ID	TkA06G165250
OH-1004 ID	LXL04_024198
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 64.356 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G165250

Location Chr06:43541846-43542660 (-)

Description Similar to RPS15A: 40S ribosomal protein S15a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P42798`	Small ribosomal subunit protein uS8z/uS8w.	No verified direct reference in this release
`At3g46040`	Small ribosomal subunit protein uS8x.	No verified direct reference in this release
`At2g39590`	Small ribosomal subunit protein uS8y.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024198 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT1G07770

ath:AT2G39590

ath:AT3G46040

ath:AT5G59850

bna:106346392

bna:106362258

bna:106385644

bna:106386853

bna:106411630

bna:106411828

bna:106419513

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.866

Rank 1 · TkA06G165250 · TK1151

Nucleus0.245

Rank 2 · TkA06G165250 · TK1151

Endoplasmic reticulum0.132

Rank 3 · TkA06G165250 · TK1151

Mitochondrion0.029

Rank 4 · TkA06G165250 · TK1151

Cell membrane0.021

Rank 5 · TkA06G165250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00410Ribosomal_S87-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G165250	`PF00410`	Ribosomal_S8	7	130	2.2e-21	76.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42798`	Arabidopsis thaliana	sp\|P42798\|R15A1_ARATH Small ribosomal subunit protein uS8z/uS8w	94.600%	Swiss-Prot	High
`Q9LX88`	Arabidopsis thaliana	sp\|Q9LX88\|R15A4_ARATH Small ribosomal subunit protein uS8x	93.800%	Swiss-Prot	High
`O80646`	Arabidopsis thaliana	sp\|O80646\|R15A3_ARATH Small ribosomal subunit protein uS8y	87.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card