TkA06G097470 | RubberDandelionOmics

Gene overview

TkA06G097470

Reference: TK1151 Chr: Chr06 Coordinates: 25960329-25964468 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2465 bp · TkA06G097470|TK1151|cDNA

GAAACATTGTGAAAGAGAGGTGATCCAAGCATATTTTATGTTACATTCATATCTCCACCCAACCTACATTGATTATAAATTTTGTCCTCTGTTTGAACTCTCCATGGTCTTTCATGAAACTACAACTCTCTACATCCCCATGTCACACAGCACCAAAGCTCTGCAAATCCTCAAGAAAACAGTTCCGGTAAAAGCTTCAGCTACTGGTTCAGATGCTGAAGATGCAAAGATTACGATCAAGAAAGACAAAAACCGGTGGA...

CDS

Download CDS FASTA

678 bp · TkA06G097470|TK1151|CDS

ATGGATAGAGCTGGATTAGTTGGGGCGGATGGGCCCACACACTGTGGAGCTTTTGATATTGCTTACATGGCATGTCTACCAAACATGGTGGTCATGGCTCCATCAGATGAAGCCGAGCTCATAAACATGGTGGCTACAGCTGCAGCCATTGATGACAGGCCAAGCTGCTTCAGATTCCCAAGAGGCAATGGCATTGGTGTACCTCTTCCTCCTAACAACAAAGGAGTTCCCATCGAGGTGGGTAAGGGGAGAATACTAGT...

Protein

Download Protein FASTA

225 aa · TkA06G097470|TK1151|PROTEIN

MDRAGLVGADGPTHCGAFDIAYMACLPNMVVMAPSDEAELINMVATAAAIDDRPSCFRFPRGNGIGVPLPPNNKGVPIEVGKGRILVEGTRVAILGYGSIIQQCLGAASLLQDHNVSVTVADARFCKPLDADLIKRLANEHEILLTVEEGSIGGFGSHVAHFLSLNGILDGKLKLRAMTLPDRYIDHGAPQDQLEEAGLSSKHICSTVLSLVGMPKQAFEYKTII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G097470`
TK1151 ID	TkA06G097470
OH-1004 ID	LXL04_028318
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.400
Protein coverage (%)	TK1151 96.000 / OH-1004 25.293 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G097470

Location Chr06:25960329-25964468 (-)

Description Similar to Os07g0190000: Probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15560`	Catalyzes the acyloin condensation reaction between C atoms 2 and 3 of pyruvate and glyceraldehyde 3-phosphate to yield 1-deoxy-D- xylulose-5-phosphate (DXP).	Analysis of the expression of CLA1, a gene that encodes the 1-deoxyxylulose 5-phosphate synthase of the 2-C-methyl-D-erythritol-4-phosphate pathway in Arabidopsis.2000 · DOI: 10.1104/pp.124.1.95 CLA1, a novel gene required for chloroplast development, is highly conserved in evolution.1996 · DOI: 10.1046/j.1365-313x.1996.9050649.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0190000`	Catalyzes the acyloin condensation reaction between C atoms 2 and 3 of pyruvate and glyceraldehyde 3-phosphate to yield 1-deoxy-D-xylulose-5-phosphate (DXP).	No verified direct reference in this release
`Os05g0408900`	Catalyzes the acyloin condensation reaction between C atoms 2 and 3 of pyruvate and glyceraldehyde 3-phosphate to yield 1-deoxy-D-xylulose-5-phosphate (DXP).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028318 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009228 thiamine biosynthetic process Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0008661 1-deoxy-D-xylulose-5-phosphate synthase activity Molecular Function

GO:0016744 transketolase or transaldolase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G15560

dosa:Os07g0190000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.393

Rank 1 · TkA06G097470 · TK1151

Cytoplasm0.353

Rank 2 · TkA06G097470 · TK1151

Nucleus0.156

Rank 3 · TkA06G097470 · TK1151

Plastid0.111

Rank 4 · TkA06G097470 · TK1151

Peroxisome0.072

Rank 5 · TkA06G097470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02779Transket_pyr2-63 aa

PF02780Transketolase_C81-204 aa

PF22613Transketolase_C_190-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G097470	`PF02779`	Transket_pyr	2	63	1.4e-15	58.1
TkA06G097470	`PF02780`	Transketolase_C	81	204	1.7e-33	115.9
TkA06G097470	`PF22613`	Transketolase_C_1	90	121	0.03	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38854`	Arabidopsis thaliana	sp\|Q38854\|DXS_ARATH 1-deoxy-D-xylulose-5-phosphate synthase, chloroplastic	75.200%	Swiss-Prot	High
`Q6YU51`	Oryza sativa subsp. japonica	sp\|Q6YU51\|DXS2_ORYSJ Probable 1-deoxy-D-xylulose-5-phosphate synthase 2, chloroplastic	76.800%	Swiss-Prot	High
`O22567`	Oryza sativa subsp. japonica	sp\|O22567\|DXS1_ORYSJ 1-deoxy-D-xylulose-5-phosphate synthase 1, chloroplastic	74.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card