Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1452 bp · TkA06G086050|TK1151|cDNA
AAAAACAATATCGTCTTTCTCTCACAATTTACACATTTATGTGTAGAGAGAAAAGAGAAACCACGTACAAGTACGATTACAAGCTGAAAGAGGAGCACACATAAATGAATGGATTCCACTGTGCAAATTGATGAGTGCTCCTTACAAGAAGGATTTCCAATGCTGAAAGCAAAACCCTCGTAACACCCTCAAAGATTCATAACTTTCTTGCCTTTCAACACATCCGATCCCCATCGTGTTTTATTCATTCAAAGAAAGAT...
825 bp · TkA06G086050|TK1151|CDS
ATGGGGGATCATTTCGTGTTTTTGGTCGATCGATTACTCACTGAATCAACATTAGAGGCTGCAATCGAAAGCAGAAACCCTAAAAAGCAGTTGGATCCCTTGGGAAAAGACGACACAGTTATTGATTGTTCATCTTCTTCTAACGTTGACTTCACTCCAAAGAAATTGGTTGAATGTAGGATATGTCAAGATGAGGATTTTGATTCCAATATGGAGACCCCATGCTCTTGTTGTGGCAGCTTGAAGTATGCTCATCGCAG...
Protein
Download Protein FASTA274 aa · TkA06G086050|TK1151|PROTEIN
MGDHFVFLVDRLLTESTLEAAIESRNPKKQLDPLGKDDTVIDCSSSSNVDFTPKKLVECRICQDEDFDSNMETPCSCCGSLKYAHRRCVQRWCNEKGDTMCEICHQQFKPGYTAPSRIFRLGGIPLNLRGHWHIARRDTITNNNPQLITVVSRDRSFLNQEYDEYADPTSRSFTCFRSVAAIFVVLLFLRHSLPAIVNGTWNYSFPMFMLWFIRTSAIVVPIYIMMRAMAALIHWRRRLAWNASTSPLSSSDDDDEGEGS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G086050 |
|---|---|
| TK1151 ID | TkA06G086050 |
| OH-1004 ID | LXL04_025037 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G086050 |
|---|---|
| Location | Chr06:23027672-23030820 (-) |
| Description | Similar to SUD1: Probable E3 ubiquitin ligase SUD1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006897 endocytosis Biological Process GO:0008299 isoprenoid biosynthetic process Biological Process GO:0009414 response to water deprivation Biological Process GO:0010025 wax biosynthetic process Biological Process GO:0010143 cutin biosynthetic process Biological Process GO:0010345 suberin biosynthetic process Biological Process GO:0016567 protein ubiquitination Biological Process GO:0036503 ERAD pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0044790 suppression of viral release by host Biological Process GO:0140367 antibacterial innate immune response Biological Process GO:0140374 antiviral innate immune response Biological Process |
| KEGG gene cross-reference | ath:AT4G34100 bta:508949 dre:100000640 dre:555611 rno:362849 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05290Baculo_IE-151-110 aaPF12906RINGv59-104 aaPF12428DUF3675110-229 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G086050 | PF05290 | Baculo_IE-1 | 51 | 110 | 0.021 | 15.5 |
| TkA06G086050 | PF12906 | RINGv | 59 | 104 | 5.4e-12 | 46.4 |
| TkA06G086050 | PF12428 | DUF3675 | 110 | 229 | 1.7e-36 | 126.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.