TkA06G067750 | RubberDandelionOmics

Gene overview

TkA06G067750

Reference: TK1151 Chr: Chr06 Coordinates: 18134547-18137365 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1378 bp · TkA06G067750|TK1151|cDNA

GTCAAGCCGAACTATCGGCATGACGTCTTTATAACACGTCCCTTTACCCCCTCTCTCAATTTCTATTACCCTAATTTTACGCGGGAAAACACTACAGCAAAAAGAGGGAGAAATGGCGACCGAGGACAACGGCGGCGAAGACTACCAAGTGGAGGAGGAATTCCGTGTCTGGAAGAAGAACACACCTATCTTGTACGACCTCGTTGTCTCTCACGCTCTTGAATGGCCGTCTCTCACTGTCCAGTGGCTTCCGTCAGAGC...

CDS

Download CDS FASTA

1197 bp · TkA06G067750|TK1151|CDS

ATGGCGACCGAGGACAACGGCGGCGAAGACTACCAAGTGGAGGAGGAATTCCGTGTCTGGAAGAAGAACACACCTATCTTGTACGACCTCGTTGTCTCTCACGCTCTTGAATGGCCGTCTCTCACTGTCCAGTGGCTTCCGTCAGAGCCGTCACTGGACTCCGACGGTTCATTCGCCGTTCACAAGCTGATCCTTGGGACACACACCTCCGACGACTATCCTAATTTTTTACTCGTTGCAGAAGTCCTCTTGCCGGTCGA...

Protein

Download Protein FASTA

398 aa · TkA06G067750|TK1151|PROTEIN

MATEDNGGEDYQVEEEFRVWKKNTPILYDLVVSHALEWPSLTVQWLPSEPSLDSDGSFAVHKLILGTHTSDDYPNFLLVAEVLLPVDNSTSIESNLENHKIPKVEVIQKIHVDGEVNRARCMPQIPSIMAAKTSSSEIYVFDSTKQPLDHEGASCEPDVRLRGHDKEGFGLSWNPFKTGYLLSGSNDCKICLWDLSTMPDNKVLDAKHIYEGHGSVVGDVSWHLKNENLFGSVGDDCKLMIWDLRTNTHQQSVVVHEKEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G067750`
TK1151 ID	TkA06G067750
OH-1004 ID	LXL04_025314
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G067750

Location Chr06:18134547-18137365 (-)

Description Similar to MSI2: WD-40 repeat-containing protein MSI2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16780`	Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA.	No verified direct reference in this release
`At4g35050`	Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA.	No verified direct reference in this release
`At5g58230`	Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA.	Arabidopsis MSI1 is required for epigenetic maintenance of reproductive development.2003 · DOI: 10.1242/dev.00470 Arabidopsis MSI1 is a component of the MEA/FIE Polycomb group complex and required for seed development.2003 · DOI: 10.1093/emboj/cdg444 Identification of new members of Fertilisation Independent Seed Polycomb Group pathway involved in the control of seed development in Arabidopsis thaliana.2004 · DOI: 10.1242/dev.01168 Loss of function of MULTICOPY SUPPRESSOR OF IRA 1 produces nonviable parthenogenetic embryos in Arabidopsis.2005 · DOI: 10.1016/j.cub.2005.02.066 Chromatin assembly factor CAF-1 is required for cellular differentiation during plant development.2006 · DOI: 10.1242/dev.02599 Retinoblastoma and its binding partner MSI1 control imprinting in Arabidopsis.2008 · DOI: 10.1371/journal.pbio.0060194

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025314 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010026 trichome differentiation Biological Process

GO:0010214 seed coat development Biological Process

KEGG gene cross-reference

ath:AT2G16780

ath:AT4G35050

ath:AT5G58230

dosa:Os03g0640100

sly:543534

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.751

Rank 1 · TkA06G067750 · TK1151

Cytoplasm0.408

Rank 2 · TkA06G067750 · TK1151

Cell membrane0.028

Rank 3 · TkA06G067750 · TK1151

Mitochondrion0.025

Rank 4 · TkA06G067750 · TK1151

Lysosome / Vacuole0.024

Rank 5 · TkA06G067750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23775Beta-prop_RIG_2nd12-50 aa

PF12265CAF1C_H4-bd15-85 aa

PF25168Beta-prop_WDR36-Utp21_2nd90-197 aa

PF29037DSE1_N98-214 aa

PF23609Beta-prop_EIPR1102-193 aa

PF25171Beta-prop_WDR36-Utp21_1st103-147 aa

PF23775Beta-prop_RIG_2nd108-203 aa

PF24807WD40_CDC20-Fz112-252 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G067750	`PF23775`	Beta-prop_RIG_2nd	12	50	5e-15	56.4
TkA06G067750	`PF12265`	CAF1C_H4-bd	15	85	1.8e-26	92.9
TkA06G067750	`PF25168`	Beta-prop_WDR36-Utp21_2nd	90	197	1e-12	48.8
TkA06G067750	`PF29037`	DSE1_N	98	214	1.1e-09	38.6
TkA06G067750	`PF23609`	Beta-prop_EIPR1	102	193	6.5e-17	62.6
TkA06G067750	`PF25171`	Beta-prop_WDR36-Utp21_1st	103	147	3.5e-11	43.7
TkA06G067750	`PF23775`	Beta-prop_RIG_2nd	108	203	5e-15	56.4
TkA06G067750	`PF24807`	WD40_CDC20-Fz	112	252	4.4e-25	89.3
TkA06G067750	`PF25173`	Beta-prop_WDR3_1st	114	286	1.8e-23	83.9
TkA06G067750	`PF30361`	TRM82_WD	119	140	5.1	6.6
TkA06G067750	`PF23756`	Beta-prop_HPS5	133	253	0.0002	21.4
TkA06G067750	`PF25174`	Beta-prop_THOC3	152	199	2.5e-33	116.0
TkA06G067750	`PF24814`	WD40_Prp19	158	325	3.6e-18	66.3
TkA06G067750	`PF24817`	WD40_WDHD1_1st	159	225	8.3e-10	39.0
TkA06G067750	`PF25175`	Beta-prop_WDR5	160	206	4.4e-24	86.0
TkA06G067750	`PF23381`	Beta-prop_IFT122_1st	160	197	1.2e-15	58.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22468`	Arabidopsis thaliana	sp\|O22468\|MSI2_ARATH WD-40 repeat-containing protein MSI2	62.100%	Swiss-Prot	High
`O22469`	Arabidopsis thaliana	sp\|O22469\|MSI3_ARATH WD-40 repeat-containing protein MSI3	58.800%	Swiss-Prot	High
`O22467`	Arabidopsis thaliana	sp\|O22467\|MSI1_ARATH Histone-binding protein MSI1	51.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card