TkA06G033880 | RubberDandelionOmics

Gene overview

TkA06G033880

Reference: TK1151 Chr: Chr06 Coordinates: 9172481-9174967 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1856 bp · TkA06G033880|TK1151|cDNA

CCGGGTTATAACTGGGGTTTGGCAATTTATTCGAAAATGAAGCCGTACGTCTCTCTCAAACCCTAGGGATCACAGTATTCGAGTTTCACCCATCGGGATGATGTTACTTTCGGATATTCTTTTGAATCGGCATCAGTTGATTGGAGGCGGATTGATTAAGCGCAGATCAACTACGAAAAGAGATATCTTCAACAAGGCAGAGCTAAAAATGGACTTTGATCACAAGAATGTTAGACTCATGGTAGAGGAAGATAGATTGA...

CDS

Download CDS FASTA

1419 bp · TkA06G033880|TK1151|CDS

ATGATGTTACTTTCGGATATTCTTTTGAATCGGCATCAGTTGATTGGAGGCGGATTGATTAAGCGCAGATCAACTACGAAAAGAGATATCTTCAACAAGGCAGAGCTAAAAATGGACTTTGATCACAAGAATGTTAGACTCATGGTAGAGGAAGATAGATTGAGCAGTTTACCAGATGAACTTCTTCATAAGATCCTATCTTCGTTTGACACAAAATTTGCTGTTCAAACATGTTTGCTGTCACCAAGATGGAAGCTTCT...

Protein

Download Protein FASTA

472 aa · TkA06G033880|TK1151|PROTEIN

MMLLSDILLNRHQLIGGGLIKRRSTTKRDIFNKAELKMDFDHKNVRLMVEEDRLSSLPDELLHKILSSFDTKFAVQTCLLSPRWKLLWTSMPSLNFLSGQFCTLPKFSKFVTNVLSHHNHQIEVSSLKLDFHGSASQVFVKKVANYAFSHNIQQLTIKCWPKKQYQFPLCLFSSQSLKHFRLCNRFSYPPCITPKTPWDFPSLTTLHLCDITLCDNHTQNSLDLFSKCVNLNSLTLKRFTIRGVKVFDIITPRLSTLVLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G033880`
TK1151 ID	TkA06G033880
OH-1004 ID	LXL04_025892
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.600
Protein coverage (%)	TK1151 93.008 / OH-1004 17.692 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G033880

Location Chr06:9172481-9174967 (+)

Description Similar to PDH-E1 ALPHA: Pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At2g29930`	F-box/LRR-repeat protein At2g29930.	No verified direct reference in this release
`At3g49480`	Putative F-box/FBD/LRR-repeat protein At3g49480.	No verified direct reference in this release
`At1g32020`	Putative F-box protein At1g32020.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025892 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0045254 pyruvate dehydrogenase complex Cellular Component

GO:0004739 pyruvate dehydrogenase (acetyl-transferring) activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G01090

dosa:Os04g0119400

rco:RC0347

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.856

Rank 1 · TkA06G033880 · TK1151

Cytoplasm0.170

Rank 2 · TkA06G033880 · TK1151

Cell membrane0.039

Rank 3 · TkA06G033880 · TK1151

Endoplasmic reticulum0.032

Rank 4 · TkA06G033880 · TK1151

Plastid0.018

Rank 5 · TkA06G033880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box54-93 aa

PF12937F-box-like54-85 aa

PF23622LRR_At1g61320_AtMIF1117-282 aa

PF24758LRR_At5g56370150-282 aa

PF12799LRR_4176-209 aa

PF12799LRR_4202-238 aa

PF12799LRR_4257-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G033880	`PF00646`	F-box	54	93	1.8e-07	31.5
TkA06G033880	`PF12937`	F-box-like	54	85	0.047	14.2
TkA06G033880	`PF23622`	LRR_At1g61320_AtMIF1	117	282	6.5e-10	39.7
TkA06G033880	`PF24758`	LRR_At5g56370	150	282	1.2e-08	35.6
TkA06G033880	`PF12799`	LRR_4	176	209	2.5	9.2
TkA06G033880	`PF12799`	LRR_4	202	238	2.5	9.2
TkA06G033880	`PF12799`	LRR_4	257	270	2.5	9.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	28.800%	Swiss-Prot	Low
`Q84RK6`	Arabidopsis thaliana	sp\|Q84RK6\|FBL36_ARATH F-box/LRR-repeat protein At2g29930	29.500%	Swiss-Prot	Low
`Q9CA04`	Arabidopsis thaliana	sp\|Q9CA04\|FDL45_ARATH Putative F-box/FBD/LRR-repeat protein At3g49480	53.200%	Swiss-Prot	Low
`Q9C6W9`	Arabidopsis thaliana	sp\|Q9C6W9\|FB28_ARATH Putative F-box protein At1g32020	26.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card