TkA05G464800 | RubberDandelionOmics

Gene overview

TkA05G464800

Reference: TK1151 Chr: Chr05 Coordinates: 116452190-116455965 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1435 bp · TkA05G464800|TK1151|cDNA

CCCCAATCCCCAACTTCTTTCATAAACCAAAACCCATTGACAGAGGCAGCCGTTGCTTTTCAAAAACAAGAAAAGAAAACCTTCCTCTCAACCCCTCTTTCTCCTCTCAATTCCTCCACAATCCCATGATCAACAATCTCATGGTTTGACTTTGACTTTTCCCGTCAGTCATGGAGGAAGAATCATCATCCAGATCACTCCTCCTGGAGGATTTTGGTCAGAAGGTGGATCTCACCAGGAGAATCAGAGAAGTTTTGTTG...

CDS

Download CDS FASTA

2073 bp · TkA05G464800|TK1151|CDS

ATGACTGTACAAATTAATGGCTACTTTGAGGTGTCATCAAACAGGCGTGTGATTTGGTATGGTGCTGACATGGACAGAAGTGGAAGAATACGGTCTCTATGGAACAGGCTTCTATTAGAAGATGTTGTTGCTTCTTCTTTCATTAAATTACTGCTTCAAGTACAACATATCCTGGGTCCCACAAGCTCATACTACTCTTTATGGCCTACTGGATCCTTTGAGGAGCCATGGAACATTATGGTGGAACGTATTTATAAAAG...

Protein

Download Protein FASTA

690 aa · TkA05G464800|TK1151|PROTEIN

MTVQINGYFEVSSNRRVIWYGADMDRSGRIRSLWNRLLLEDVVASSFIKLLLQVQHILGPTSSYYSLWPTGSFEEPWNIMVERIYKSIGDSCVLHSDLDGGKWVSVMEAFLHDNEFCKSNELGKALVQMGLPIVHLPIALRDMLLKFASNLKVVTPDSVRIFLRKSKGIHKLTSDLKLVFSEYCLLYLKPPFLYENFYGLPLLPLSNGLFTEFGDRVYLARGDAYNLLKDSYSDQLLDSEIPYTIYEKLREMGENFYLLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G464800`
TK1151 ID	TkA05G464800
OH-1004 ID	LXL04_022397
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.700
Protein coverage (%)	TK1151 76.667 / OH-1004 11.517 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G464800`
Location	Chr05:116452190-116455965 (+)
Description	Similar to Sacs: Sacsin
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022397` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0090084 negative regulation of inclusion body assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0030544 Hsp70 protein binding Molecular Function GO:0042802 identical protein binding Molecular Function GO:0050750 low-density lipoprotein particle receptor binding Molecular Function GO:0051087 protein-folding chaperone binding Molecular Function GO:0070628 proteasome binding Molecular Function
KEGG gene cross-reference	mmu:50720 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.605

Rank 1 · TkA05G464800 · TK1151

Cytoplasm0.401

Rank 2 · TkA05G464800 · TK1151

Cell membrane0.056

Rank 3 · TkA05G464800 · TK1151

Golgi apparatus0.043

Rank 4 · TkA05G464800 · TK1151

Mitochondrion0.042

Rank 5 · TkA05G464800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21362Sina_RING183-192 aa

PF13445zf-RING_UBOX525-534 aa

PF15616TerY_C643-683 aa

PF13920zf-C3HC4_3644-684 aa

PF24921RING_XB3-XBAT31644-671 aa

PF14447Prok-RING_4645-686 aa

PF14634zf-RING_5645-679 aa

PF00097zf-C3HC4645-678 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G464800	`PF21362`	Sina_RING	183	192	3.5	8.6
TkA05G464800	`PF13445`	zf-RING_UBOX	525	534	0.006	17.3
TkA05G464800	`PF15616`	TerY_C	643	683	0.3	12.0
TkA05G464800	`PF13920`	zf-C3HC4_3	644	684	5.4e-11	42.8
TkA05G464800	`PF24921`	RING_XB3-XBAT31	644	671	0.0015	19.2
TkA05G464800	`PF14447`	Prok-RING_4	645	686	1.8e-07	31.6
TkA05G464800	`PF14634`	zf-RING_5	645	679	0.00025	21.7
TkA05G464800	`PF00097`	zf-C3HC4	645	678	0.00027	21.4
TkA05G464800	`PF13639`	zf-RING_2	645	679	0.0013	19.6
TkA05G464800	`PF13445`	zf-RING_UBOX	645	669	0.006	17.3
TkA05G464800	`PF13923`	zf-C3HC4_2	645	678	0.02	15.4
TkA05G464800	`PF21362`	Sina_RING	645	678	3.5	8.6
TkA05G464800	`PF14570`	zf-RING_4	653	679	8.0	7.1
TkA05G464800	`PF24921`	RING_XB3-XBAT31	672	683	0.0015	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card