TkA04G511190 | RubberDandelionOmics

Gene overview

TkA04G511190

Reference: TK1151 Chr: Chr04 Coordinates: 129092518-129104035 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1980 bp · TkA04G511190|TK1151|cDNA

ATGGTGGAGCTTAAAGTTCCATCGGAGGAAGATTTCCTACACGGCACCGTTTCATCCAACAGACGGCGTGCCCATAACAAAAACGCCAGGCAGCTGACATGGGTTCTATTCCTCAAGGCCCATCGTGCCGCCGGTTGTATTACCTCCATCGCCTCCACCACATTCTCCCTTACTTACGCTGTCCGCCGCCGTGTAACATCCGGTCGGACAGATAAAGAAACTGATGCTGGAATCGCTGTTAGAACATCCACGCGTTTTTA...

CDS

Download CDS FASTA

1980 bp · TkA04G511190|TK1151|CDS

ATGGTGGAGCTTAAAGTTCCATCGGAGGAAGATTTCCTACACGGCACCGTTTCATCCAACAGACGGCGTGCCCATAACAAAAACGCCAGGCAGCTGACATGGGTTCTATTCCTCAAGGCCCATCGTGCCGCCGGTTGTATTACCTCCATCGCCTCCACCACATTCTCCCTTACTTACGCTGTCCGCCGCCGTGTAACATCCGGTCGGACAGATAAAGAAACTGATGCTGGAATCGCTGTTAGAACATCCACGCGTTTTTA...

Protein

Download Protein FASTA

659 aa · TkA04G511190|TK1151|PROTEIN

MVELKVPSEEDFLHGTVSSNRRRAHNKNARQLTWVLFLKAHRAAGCITSIASTTFSLTYAVRRRVTSGRTDKETDAGIAVRTSTRFYACIKACLLLSVLLLGFEIAAYFKGWQFGLPDLHLQYGFFDWIYSKWVLIRVEFLAPPLQILANSCVYLFLVQSLDRFILCLGCLLIRVMKMKPVAKQAVHDLESGLGDGFFPMVLVQIPMCNEKEVYQQSIGAVCSLTWPKSKILIQVLDDSDDPTTQLLIKDEVRKWKRDGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G511190`
TK1151 ID	TkA04G511190
OH-1004 ID	LXL04_030270
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.500
Protein coverage (%)	TK1151 100.000 / OH-1004 95.595 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G511190

Location Chr04:129092518-129104035 (+)

Description Similar to CSLC12: Probable xyloglucan glycosyltransferase 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g07960`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0510800`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release
`UniProt: A2YHR9`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release
`Os07g0124750`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release
`Os01g0766900`	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030270 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048868 pollen tube development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0099402 plant organ development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT4G07960

ath:AT4G31590

dosa:Os05g0510800

osa:107275797

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.395

Rank 1 · TkA04G511190 · TK1151

Golgi apparatus0.264

Rank 2 · TkA04G511190 · TK1151

Cell membrane0.167

Rank 3 · TkA04G511190 · TK1151

Cytoplasm0.121

Rank 4 · TkA04G511190 · TK1151

Nucleus0.108

Rank 5 · TkA04G511190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13506Glyco_transf_21196-443 aa

PF13641Glyco_tranf_2_3199-432 aa

PF00535Glycos_transf_2204-342 aa

PF13632Glyco_trans_2_3248-262 aa

PF03142Chitin_synth_2281-382 aa

PF13632Glyco_trans_2_3293-486 aa

PF16370MetallophosC347-405 aa

PF03142Chitin_synth_2403-527 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G511190	`PF13506`	Glyco_transf_21	196	443	3.1e-14	53.3
TkA04G511190	`PF13641`	Glyco_tranf_2_3	199	432	2.7e-14	54.2
TkA04G511190	`PF00535`	Glycos_transf_2	204	342	1.3e-10	42.2
TkA04G511190	`PF13632`	Glyco_trans_2_3	248	262	2e-19	70.9
TkA04G511190	`PF03142`	Chitin_synth_2	281	382	8.6e-07	28.7
TkA04G511190	`PF13632`	Glyco_trans_2_3	293	486	2e-19	70.9
TkA04G511190	`PF16370`	MetallophosC	347	405	0.34	11.6
TkA04G511190	`PF03142`	Chitin_synth_2	403	527	8.6e-07	28.7
TkA04G511190	`PF12578`	3-PAP	418	456	0.21	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQB9`	Arabidopsis thaliana	sp\|Q9ZQB9\|CSLCC_ARATH Probable xyloglucan glycosyltransferase 12	74.300%	Swiss-Prot	High
`Q6L538`	Oryza sativa subsp. japonica	sp\|Q6L538\|CSLC7_ORYSJ Probable xyloglucan glycosyltransferase 7	70.100%	Swiss-Prot	High
`A2YHR9`	Oryza sativa subsp. indica	sp\|A2YHR9\|CSLCA_ORYSI Putative xyloglucan glycosyltransferase 10	69.500%	Swiss-Prot	High
`Q84Z01`	Oryza sativa subsp. japonica	sp\|Q84Z01\|CSLCA_ORYSJ Putative xyloglucan glycosyltransferase 10	69.500%	Swiss-Prot	High
`Q8LIY0`	Oryza sativa subsp. japonica	sp\|Q8LIY0\|CSLC1_ORYSJ Probable xyloglucan glycosyltransferase 1	68.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card