TkA04G468180 | RubberDandelionOmics

Gene overview

TkA04G468180

Reference: TK1151 Chr: Chr04 Coordinates: 118189428-118193353 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2152 bp · TkA04G468180|TK1151|cDNA

CAATTGTCCATACTTTAGGTCTATGACGGCCCAAAAACCTTCAAAATCGAGTATGCTGTAAAGGTACTAGCATGTCTGCACAAGGTACAATCTCTACCATAACCTCGATGAGAGCGAATAGACCTGGTATCAAATCATCTCCCCAGTGGGCTGCCCATAGATATATCCCGCGTCTCTCGAGGTCTAAAGAACTTCGCTGCTGTTAATTAGTGCTGGTTTGGGGTTCCAATAGCTAACTTCGGGTTCTTAGCATTTAAAGT...

CDS

Download CDS FASTA

1536 bp · TkA04G468180|TK1151|CDS

ATGACCTGCATTTCGCATAATCTTGGAGCTTCAATGAAATTAGGTCATCTCCGAGTATCAAATCAGAGACAGTTTCCAAACAAAATCTCCCAACTCTTTTTCCTTCAAACCAAGACCTTCAAATCATCAAAAACTTTCAATCCCCACAATAATTTCCACCGTTTAAATCGCCATAAATCCACCATTTCCAACAGCATTTCTCCAAACAATCCAGAACAAAGAGTGACTGTACTTGTAATTGGTGGAGGAGGAAGAGAACA...

Protein

Download Protein FASTA

511 aa · TkA04G468180|TK1151|PROTEIN

MTCISHNLGASMKLGHLRVSNQRQFPNKISQLFFLQTKTFKSSKTFNPHNNFHRLNRHKSTISNSISPNNPEQRVTVLVIGGGGREHSLCYALKRSHSCDAVFCAPGNPGISNSGDATCIQDLDVSDSEAVIGFCRKWGVGLVVVGPEAPLVAGLTNDLLKAGIHAFGPSSEAAALEGSKNFMKSICDKYGIPTAKYAAFTDPSAAKTYIISQGAPIVVKADGLAAGKGVIVATSLHEAFEAVDSILISGSFGTAGSSII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G468180`
TK1151 ID	TkA04G468180
OH-1004 ID	LXL04_038806
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 95.872 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G468180

Location Chr04:118189428-118193353 (-)

Description Similar to PUR2: Phosphoribosylamine--glycine ligase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09830`	Phosphoribosylamine--glycine ligase, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038806 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006189 'de novo' IMP biosynthetic process Biological Process

GO:0009113 purine nucleobase biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004637 phosphoribosylamine-glycine ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G09830

atu:Atu0647

mlo:mlr7447

sme:SMc00993

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.945

Rank 1 · TkA04G468180 · TK1151

Mitochondrion0.104

Rank 2 · TkA04G468180 · TK1151

Cytoplasm0.056

Rank 3 · TkA04G468180 · TK1151

Peroxisome0.029

Rank 4 · TkA04G468180 · TK1151

Nucleus0.022

Rank 5 · TkA04G468180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02844GARS_N76-177 aa

PF01071GARS_A178-372 aa

PF13549ATP-grasp_5183-222 aa

PF02786CPSase_L_D2183-267 aa

PF08442ATP-grasp_2184-248 aa

PF02222ATP-grasp187-266 aa

PF02655ATP-grasp_3207-288 aa

PF13535ATP-grasp_4215-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G468180	`PF02844`	GARS_N	76	177	3e-31	108.8
TkA04G468180	`PF01071`	GARS_A	178	372	9.2e-83	277.6
TkA04G468180	`PF13549`	ATP-grasp_5	183	222	0.084	12.9
TkA04G468180	`PF02786`	CPSase_L_D2	183	267	0.16	12.2
TkA04G468180	`PF08442`	ATP-grasp_2	184	248	0.21	11.9
TkA04G468180	`PF02222`	ATP-grasp	187	266	0.00043	20.7
TkA04G468180	`PF02655`	ATP-grasp_3	207	288	0.028	15.2
TkA04G468180	`PF13535`	ATP-grasp_4	215	279	0.026	14.8
TkA04G468180	`PF02843`	GARS_C	407	500	1.9e-31	108.9
TkA04G468180	`PF02786`	CPSase_L_D2	457	481	0.16	12.2
TkA04G468180	`PF21244`	PurT_C	458	486	0.23	11.7
TkA04G468180	`PF18603`	LAL_C2	458	488	0.26	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P52420`	Arabidopsis thaliana	sp\|P52420\|PUR2_ARATH Phosphoribosylamine--glycine ligase, chloroplastic	76.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card