TkA04G373160 | RubberDandelionOmics

Gene overview

TkA04G373160

Reference: TK1151 Chr: Chr04 Coordinates: 93771219-93773005 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA04G373160|TK1151|cDNA

ATGAAATCAGACGAACTGCTAATATGCTCCAATAAGCATCGCAATCCTCCTTATATATGCTCCAATCTCACAGGAACCATTCACAATCCTAGAAGCAATCGAGCTATGCTCGAGAACACCATGGGAAGTGAAGATAGCTACAAGAATGGTGATTCAGTATGGATGGGGCGAGATGACAGTCCAACACTTTATCACCATGGCAATGCTGTCACTGCTTTAAGTATAGGGGACAATCATGAGTATGAGATGGCAGCTACAGT...

CDS

Download CDS FASTA

384 bp · TkA04G373160|TK1151|CDS

ATGAAATCAGACGAACTGCTAATATGCTCCAATAAGCATCGCAATCCTCCTTATATATGCTCCAATCTCACAGGAACCATTCACAATCCTAGAAGCAATCGAGCTATGCTCGAGAACACCATGGGAAGTGAAGATAGCTACAAGAATGGTGATTCAGTATGGATGGGGCGAGATGACAGTCCAACACTTTATCACCATGGCAATGCTGTCACTGCTTTAAGTATAGGGGACAATCATGAGTATGAGATGGCAGCTACAGT...

Protein

Download Protein FASTA

127 aa · TkA04G373160|TK1151|PROTEIN

MKSDELLICSNKHRNPPYICSNLTGTIHNPRSNRAMLENTMGSEDSYKNGDSVWMGRDDSPTLYHHGNAVTALSIGDNHEYEMAATVEKMYDLAYEKAKTILLSNQNVVEKTVEELLQFEILTGNVI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G373160`
TK1151 ID	TkA04G373160
OH-1004 ID	LXL04_003082
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 73.837 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G373160

Location Chr04:93771219-93773005 (-)

Description Similar to FTSHI5: Probable inactive ATP-dependent zinc metalloprotease FTSHI 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04340`	Required for plastid development during embryogenesis.	FtsHi4 is essential for embryogenesis due to its influence on chloroplast development in Arabidopsis.2014 · DOI: 10.1371/journal.pone.0099741

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003082 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0080093 regulation of photorespiration Biological Process

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0062091 Ycf2/FtsHi complex Cellular Component

KEGG gene cross-reference

ath:AT3G04340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.424

Rank 1 · TkA04G373160 · TK1151

Nucleus0.348

Rank 2 · TkA04G373160 · TK1151

Mitochondrion0.103

Rank 3 · TkA04G373160 · TK1151

Extracellular0.098

Rank 4 · TkA04G373160 · TK1151

Cell membrane0.053

Rank 5 · TkA04G373160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01434Peptidase_M4166-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G373160	`PF01434`	Peptidase_M41	66	125	0.00037	21.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J3N2`	Arabidopsis thaliana	sp\|F4J3N2\|FTSI5_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 5, chloroplastic	69.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card