TkA04G364800 | RubberDandelionOmics

Gene overview

TkA04G364800

Reference: TK1151 Chr: Chr04 Coordinates: 91674329-91675648 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · TkA04G364800|TK1151|cDNA

GGTGGCGGTTGTAAACCCACTGTTCGAGAAAAGGCCGAAACAGTTTGGCATCGGAGGAGCATTGCCACCGAAGAAGGACGTTCACAGATTTGTGTGATGGCCGCAAGTTGTTCGTATTCAGAGGAAAAGAAGGATTCTCAAGCAACGTTTGAAGGTTCCACCTGCCCTAAATCAGTTCACCAAGGATTCTAGGTAATAATTTAGCAACCACTTTGTTCAAGATGCTCCTCAAGTACAGACCTGAGGATAAAGCATCAAAA...

CDS

Download CDS FASTA

501 bp · TkA04G364800|TK1151|CDS

ATGCTCCTCAAGTACAGACCTGAGGATAAAGCATCAAAAAAGGAACGCCTTCTGAAAAGAGCTCGAGCAGAATCTGAAGGAAAGACAGCTGAATCCAAGAAGCCAATTGTTGTCAAATATGGTCTTAATCATATCACCTATCTTATTGAGCAGAACAAGGCTCAGTTAGTGATCATTGCTCATGATGTGGACCCCATTGAGTTGGTTGTCTGGCTTCCTGCACTCTGCAGAAAGATGGAAATCCCTTACTGTATTGTGAA...

Protein

Download Protein FASTA

166 aa · TkA04G364800|TK1151|PROTEIN

MLLKYRPEDKASKKERLLKRARAESEGKTAESKKPIVVKYGLNHITYLIEQNKAQLVIIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGTIVHQKTAAALCLTTVKNEDKMEFSRILEAIKANFNDKYEEYRKKWGGGIMGSKSQAKQKPRRGFLPRKLLRD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G364800`
TK1151 ID	TkA04G364800
OH-1004 ID	LXL04_031529
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.500
Protein coverage (%)	TK1151 95.783 / OH-1004 61.868 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G364800

Location Chr04:91674329-91675648 (+)

Description Similar to RPL7A-2: 60S ribosomal protein L7a-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62870`	Large ribosomal subunit protein eL8y.	No verified direct reference in this release
`At2g47610`	Large ribosomal subunit protein eL8z.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0326400`	Large ribosomal subunit protein eL8z.	No verified direct reference in this release
`Os09g0507800`	Large ribosomal subunit protein eL8y.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031529 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000470 maturation of LSU-rRNA Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G47610

ath:AT3G62870

dosa:Os08g0326400

dosa:Os09g0507800

osa:4345279

tru:101064977

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.698

Rank 1 · TkA04G364800 · TK1151

Nucleus0.299

Rank 2 · TkA04G364800 · TK1151

Cell membrane0.066

Rank 3 · TkA04G364800 · TK1151

Mitochondrion0.047

Rank 4 · TkA04G364800 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA04G364800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01248Ribosomal_L7Ae26-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G364800	`PF01248`	Ribosomal_L7Ae	26	115	6.8e-26	90.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZH9`	Arabidopsis thaliana	sp\|Q9LZH9\|RL7A2_ARATH Large ribosomal subunit protein eL8y	90.200%	Swiss-Prot	High
`P49692`	Arabidopsis thaliana	sp\|P49692\|RL7A1_ARATH Large ribosomal subunit protein eL8z	88.200%	Swiss-Prot	High
`P35685`	Oryza sativa subsp. japonica	sp\|P35685\|RL7A1_ORYSJ Large ribosomal subunit protein eL8z	84.300%	Swiss-Prot	High
`P0DKK7`	Oryza sativa subsp. japonica	sp\|P0DKK7\|RL7A2_ORYSJ Large ribosomal subunit protein eL8y	84.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card