TkA03G582650 | RubberDandelionOmics

Gene overview

TkA03G582650

Reference: TK1151 Chr: Chr03 Coordinates: 147967476-147971353 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2775 bp · TkA03G582650|TK1151|cDNA

TACCGACCCGATTCAACCCGCCCAACATACGGTCAACTAAAGTCAATGAATCACCCACACTACACGTGCACATTATATACATCCTATCTTACACATTGTTCCTCTATATATATACACTTAATCCATATACAATGTCTTTCAATCACACCATTTACTCAATCTCTCTCTCTCTTTCTCAAACTCCATGGCCAATTCCCATCAGTTTCTATCTCTAGCCAACGCTTCTTTCTGTTGATTGGTTCTATCAGTCGCCAATATTA...

CDS

Download CDS FASTA

1902 bp · TkA03G582650|TK1151|CDS

ATGATTAGTGGACATGACTTCTACACCGTCATGGCAGCGATGGTGCCGTTATACGTCGCTATGATTCTGGCTTACGGCAGTGTACGGTGGTGGAAGATATTCTCCCCTGATCAGTGCTCCGGCATAAACCGATTTGTAGCTATTTTCGCCGTTCCATTACTCTCGTTTCACTTCATTTCTTTGAACAATCCGTACGAGATGAATTTCCGATTCATCGCCGCTGACACACTCCAGAAGGTCATCATGCTGGTGGTGCTCGG...

Protein

Download Protein FASTA

633 aa · TkA03G582650|TK1151|PROTEIN

MISGHDFYTVMAAMVPLYVAMILAYGSVRWWKIFSPDQCSGINRFVAIFAVPLLSFHFISLNNPYEMNFRFIAADTLQKVIMLVVLGLWANFTKNGSLEWAITIFSLSTLPNTLVMGIPLLIAMYGEYSGSLMVQVVVLQCIIWYTLLLFLFEYRGAKILILEQFPETAASIVSFKVESDVVSLDGHDFLETDAAIGNDGKLHVTVRKSNVSRRSLGLGSMTPRPSNLTGAEIYSLSSSRNQTPRGSNFNNSDFYSMMGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G582650`
TK1151 ID	TkA03G582650
OH-1004 ID	LXL04_011335
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G582650

Location Chr03:147967476-147971353 (-)

Description Similar to PIN3: Auxin efflux carrier component 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01420`	Acts as a component of the auxin efflux carrier.	Differential auxin-transporting activities of PIN-FORMED proteins in Arabidopsis root hair cells.2010 · DOI: 10.1104/pp.110.156505 Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023 Root System Depth in Arabidopsis Is Shaped by EXOCYST70A3 via the Dynamic Modulation of Auxin Transport.2019 · DOI: 10.1016/j.cell.2019.06.021
`At1g70940`	Acts as a component of the auxin efflux carrier.	Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023 Structures and mechanisms of the Arabidopsis auxin transporter PIN3.2022 · DOI: 10.1038/s41586-022-05142-w
`At1g23080`	Acts as a component of the auxin efflux carrier.	Efflux-dependent auxin gradients establish the apical-basal axis of Arabidopsis.2003 · DOI: 10.1038/nature02085 Differential auxin-transporting activities of PIN-FORMED proteins in Arabidopsis root hair cells.2010 · DOI: 10.1104/pp.110.156505 Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0643300`	Acts as a component of the auxin efflux carrier.	No verified direct reference in this release
`Os06g0232300`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011335 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009606 tropism Biological Process

GO:0009630 gravitropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009942 longitudinal axis specification Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0048364 root development Biological Process

GO:0048766 root hair initiation Biological Process

GO:0048767 root hair elongation Biological Process

KEGG gene cross-reference

ath:AT1G23080

ath:AT1G70940

ath:AT2G01420

dosa:Os02g0743400

dosa:Os06g0232300

osa:4330700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.809

Rank 1 · TkA03G582650 · TK1151

Endoplasmic reticulum0.085

Rank 2 · TkA03G582650 · TK1151

Cytoplasm0.083

Rank 3 · TkA03G582650 · TK1151

Lysosome / Vacuole0.052

Rank 4 · TkA03G582650 · TK1151

Golgi apparatus0.042

Rank 5 · TkA03G582650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03547Mem_trans10-628 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G582650	`PF03547`	Mem_trans	10	628	1.6e-130	435.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWZ6`	Arabidopsis thaliana	sp\|Q8RWZ6\|PIN4_ARATH Auxin efflux carrier component 4	69.600%	Swiss-Prot	High
`Q9S7Z8`	Arabidopsis thaliana	sp\|Q9S7Z8\|PIN3_ARATH Auxin efflux carrier component 3	68.900%	Swiss-Prot	High
`Q940Y5`	Arabidopsis thaliana	sp\|Q940Y5\|PIN7_ARATH Auxin efflux carrier component 7	69.300%	Swiss-Prot	High
`Q5VP70`	Oryza sativa subsp. japonica	sp\|Q5VP70\|PIN3A_ORYSJ Auxin efflux carrier component 3a	62.100%	Swiss-Prot	High
`Q67UL3`	Oryza sativa subsp. japonica	sp\|Q67UL3\|PIN1C_ORYSJ Probable auxin efflux carrier component 1c	62.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card