TkA03G571030 | RubberDandelionOmics

Gene overview

TkA03G571030

Reference: TK1151 Chr: Chr03 Coordinates: 144850788-144860918 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

1752 bp · TkA03G571030|TK1151|CDS

ATGTTTGTAACTGTCTTAAGTTATGTGTCCCTACGATTGCTAGGGGAAGAAAAACACGACACAAATGTTGCATTGATTCGTGCCAGAAAATGGATACTTGACCATGGTGGTGCGACCAATGTACCATCTTGGGGCAAACTTTATCTCTCGGTTCTTGGTGTATATGAATGGGAAGGATGCAACCCAATACCACCTGAATTTTGGATTTTCCCTGAGTTCTTACCATTTCATCCAGCAAAAATGTGGTGCTATTGTCGAAC...

Protein

Download Protein FASTA

583 aa · TkA03G571030|TK1151|PROTEIN

MFVTVLSYVSLRLLGEEKHDTNVALIRARKWILDHGGATNVPSWGKLYLSVLGVYEWEGCNPIPPEFWIFPEFLPFHPAKMWCYCRTAYMPMSYLYGRKFQGPITDLVLQLRKEIYLTPYNEINWNEHRHKCCKEDLYYPHTIVQDLLWDGLYYLSEPLFKFWPFTKLREKALKRTLELTRYNAEESRYITMASIEKGFQMMCWWAANPNGDEFKHHLARLPDYLWLAEDGMKSQTFGSQLWCSAFATQAIIASNMPEEY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G571030`
TK1151 ID	TkA03G571030
OH-1004 ID	LXL04_027549
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 76.913 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G571030`
Location	Chr03:144850788-144860918 (+)
Description	Similar to DDS: Dammarenediol II synthase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027549` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002238 response to molecule of fungal origin Biological Process GO:0009723 response to ethylene Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0010038 response to metal ion Biological Process GO:0016104 triterpenoid biosynthetic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0019745 pentacyclic triterpenoid biosynthetic process Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0071731 response to nitric oxide Biological Process GO:1902438 response to vanadate(3-) Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005811 lipid droplet Cellular Component
KEGG gene cross-reference	ag:BAA33461 ag:BAB83088 ag:BAF33291 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.477

Rank 1 · TkA03G571030 · TK1151

Endoplasmic reticulum0.176

Rank 2 · TkA03G571030 · TK1151

Cytoplasm0.109

Rank 3 · TkA03G571030 · TK1151

Cell membrane0.064

Rank 4 · TkA03G571030 · TK1151

Peroxisome0.054

Rank 5 · TkA03G571030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13249SQHop_cyclase_N2-179 aa

PF13243SQHop_cyclase_C18-34 aa

PF13243SQHop_cyclase_C239-578 aa

PF07678TED_complement240-277 aa

PF07687M20_dimer255-299 aa

PF09492Pec_lyase270-294 aa

PF07678TED_complement321-428 aa

PF00432Prenyltrans332-433 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G571030	`PF13249`	SQHop_cyclase_N	2	179	5.9e-33	115.0
TkA03G571030	`PF13243`	SQHop_cyclase_C	18	34	2.6e-50	172.0
TkA03G571030	`PF13243`	SQHop_cyclase_C	239	578	2.6e-50	172.0
TkA03G571030	`PF07678`	TED_complement	240	277	3.2e-05	23.9
TkA03G571030	`PF07687`	M20_dimer	255	299	0.21	12.3
TkA03G571030	`PF09492`	Pec_lyase	270	294	0.00085	19.5
TkA03G571030	`PF07678`	TED_complement	321	428	3.2e-05	23.9
TkA03G571030	`PF00432`	Prenyltrans	332	433	2.9e-06	27.7
TkA03G571030	`PF09492`	Pec_lyase	337	356	0.00085	19.5
TkA03G571030	`PF13249`	SQHop_cyclase_N	391	436	5.9e-33	115.0
TkA03G571030	`PF09492`	Pec_lyase	403	437	0.00085	19.5
TkA03G571030	`PF07687`	M20_dimer	404	447	0.21	12.3
TkA03G571030	`PF00432`	Prenyltrans	444	559	2.9e-06	27.7
TkA03G571030	`PF07678`	TED_complement	459	534	3.2e-05	23.9
TkA03G571030	`PF13249`	SQHop_cyclase_N	463	485	5.9e-33	115.0
TkA03G571030	`PF09492`	Pec_lyase	463	487	0.00085	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card