TkA03G570130 | RubberDandelionOmics

Gene overview

TkA03G570130

Reference: TK1151 Chr: Chr03 Coordinates: 144641786-144647024 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4301 bp · TkA03G570130|TK1151|cDNA

GTTGTTATTAGTTCATGACTTTTTCTATGGCTTTGAAGGTGAAATGTGTTTTTGGTTGGTGATTGTTGAAAGTTCCAACGTTTTCTACTATTCCATACGCAGTCGCAGACATGGCCATGGGCCGTCTACGAAGACCTTTTGAGGTCAAAGGAGTCCTTATTCAAACCTTCTAGTCTGTCTGTCATACGAGTCGCAATTTCCTCACGTTTTCTTATCTTCTTCTTTTTCTTAATTTCCCATTTATATACTTGGTATCTAAT...

CDS

Download CDS FASTA

3546 bp · TkA03G570130|TK1151|CDS

ATGGCACATGGGAGGAAAAAGAAGGTGCAGCTTAGCAAGATGTACTCATTTAGGAGAGAACGATTCGAAGAGGATCATTCACAGATTGGAGGACCTGGGTTTTCTAGGGTGATTTATTGCAATGAAAATGGTGAATCAGAGGGTATGATTCAAAATTACGCCGATAATTATGTGAGGTTAACAAAGTACACACCGGTGACATTTCTCCCAAAATCATTGTTTGAACAGTTTCGAAGAGTCGCTAATTTCTACTTTCTTGT...

Protein

Download Protein FASTA

1181 aa · TkA03G570130|TK1151|PROTEIN

MAHGRKKKVQLSKMYSFRRERFEEDHSQIGGPGFSRVIYCNENGESEGMIQNYADNYVRLTKYTPVTFLPKSLFEQFRRVANFYFLVAGLLAFTPLAPYSPVSAILPLIIVIGATMVKEGIEDWQRQQQDHEVNNRKTKVHRRGGVFESSQWKKIKVGDIVKVEKDQFFPADLLLLSSSYEDAICYVETMNLDGETNLKLKQSLDVTSSINEDSKFNNFKATVRCEDPNASLYTFVGTMQFQDQRYALSPQQLLLRDSKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G570130`
TK1151 ID	TkA03G570130
OH-1004 ID	LXL04_011169
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G570130

Location Chr03:144641786-144647024 (+)

Description Similar to ALA9: Putative phospholipid-transporting ATPase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68710`	Involved in transport of phospholipids.	No verified direct reference in this release
`At1g13210`	Involved in transport of phospholipids.	No verified direct reference in this release
`At3g25610`	Involved in transport of phospholipids.	No verified direct reference in this release
`At1g26130`	Involved in transport of phospholipids.	No verified direct reference in this release
`At3g27870`	Involved in transport of phospholipids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011169 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045332 phospholipid translocation Biological Process

GO:1901703 protein localization involved in auxin polar transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0090554 phosphatidylcholine floppase activity Molecular Function

GO:0140326 ATPase-coupled intramembrane lipid transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G13210

ath:AT1G26130

ath:AT1G68710

ath:AT3G25610

ath:AT3G27870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.523

Rank 1 · TkA03G570130 · TK1151

Endoplasmic reticulum0.226

Rank 2 · TkA03G570130 · TK1151

Cytoplasm0.192

Rank 3 · TkA03G570130 · TK1151

Golgi apparatus0.168

Rank 4 · TkA03G570130 · TK1151

Lysosome / Vacuole0.130

Rank 5 · TkA03G570130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16209PhoLip_ATPase_N38-105 aa

PF00122E1-E2_ATPase134-202 aa

PF16209PhoLip_ATPase_N301-308 aa

PF00702Hydrolase418-522 aa

PF13246Cation_ATPase505-702 aa

PF00702Hydrolase652-730 aa

PF03853YjeF_N706-800 aa

PF00702Hydrolase827-867 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G570130	`PF16209`	PhoLip_ATPase_N	38	105	1.2e-21	76.9
TkA03G570130	`PF00122`	E1-E2_ATPase	134	202	0.00046	20.6
TkA03G570130	`PF16209`	PhoLip_ATPase_N	301	308	1.2e-21	76.9
TkA03G570130	`PF00702`	Hydrolase	418	522	7e-13	50.1
TkA03G570130	`PF13246`	Cation_ATPase	505	702	1.1e-20	74.9
TkA03G570130	`PF00702`	Hydrolase	652	730	7e-13	50.1
TkA03G570130	`PF03853`	YjeF_N	706	800	0.22	12.1
TkA03G570130	`PF00702`	Hydrolase	827	867	7e-13	50.1
TkA03G570130	`PF08282`	Hydrolase_3	846	871	0.0019	18.7
TkA03G570130	`PF16212`	PhoLip_ATPase_C	881	1131	5.7e-90	302.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX33`	Arabidopsis thaliana	sp\|Q9SX33\|ALA9_ARATH Putative phospholipid-transporting ATPase 9	72.200%	Swiss-Prot	High
`Q9SAF5`	Arabidopsis thaliana	sp\|Q9SAF5\|ALA11_ARATH Probable phospholipid-transporting ATPase 11	70.400%	Swiss-Prot	High
`Q9LI83`	Arabidopsis thaliana	sp\|Q9LI83\|ALA10_ARATH Phospholipid-transporting ATPase 10	71.200%	Swiss-Prot	High
`P57792`	Arabidopsis thaliana	sp\|P57792\|ALA12_ARATH Probable phospholipid-transporting ATPase 12	69.400%	Swiss-Prot	High
`Q9LK90`	Arabidopsis thaliana	sp\|Q9LK90\|ALA8_ARATH Probable phospholipid-transporting ATPase 8	61.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card