Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1536 bp · TkA03G544790|TK1151|cDNA
TTGAAATAAACACGGCTCACAATAACATAACAATTTTGCCCCAATTTCCTTTTTACGCCTCTCGCACCCATCTTTTCGCAAAACCTCACGTTGCTTCTTTCTCATTTCCCGACGCCGGACGACAAAGGAGCCCTGTTACTTTCCAAAATGCCTGCACAAAAAATAGAAACTGGCCACACTGACACGGTCCACGATGTGAGCATGGACTACTACGGGAAACGTGTAGCATCCGCATCCTCCGATTCCACCATCAAAATAAT...
906 bp · TkA03G544790|TK1151|CDS
ATGCCTGCACAAAAAATAGAAACTGGCCACACTGACACGGTCCACGATGTGAGCATGGACTACTACGGGAAACGTGTAGCATCCGCATCCTCCGATTCCACCATCAAAATAATCGGTGTAACCAACAACTCCACCTCCCAACACCTCACAACCCTAACCGGCCACAACGGTCCAGTCTGGCAAGTCGCGTGGGCCCACCCCAAATTCGGGTCCCTCCTCGCCTCCTGCTCCTACGACTCAACCGTCATCCTCTGGAAAGA...
Protein
Download Protein FASTA301 aa · TkA03G544790|TK1151|PROTEIN
MPAQKIETGHTDTVHDVSMDYYGKRVASASSDSTIKIIGVTNNSTSQHLTTLTGHNGPVWQVAWAHPKFGSLLASCSYDSTVILWKEANPNEWTQVHTFTDHKSSVNSLAWAPHELGLCLACGSSDGNITVHTARSDGGWDTARIDQAHPVGVTSVTWAPSMAPGALVGSGGFEPVQKIASGGCDNTVKVWKLSNGNWKMDCFPALQMHKDWVRGVAWAPNLGLPKSTIASCSEDGTVVIWTVGKEGDNWNGKVLFDFKV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G544790 |
|---|---|
| TK1151 ID | TkA03G544790 |
| OH-1004 ID | LXL04_026410 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 84.200 |
| Protein coverage (%) | TK1151 99.003 / OH-1004 98.350Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G544790 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:137407114-137410398 (-) | |||||||||
| Description | Similar to SEC13B: Protein transport protein SEC13 homolog B | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006606 protein import into nucleus Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006913 nucleocytoplasmic transport Biological Process GO:0031669 cellular response to nutrient levels Biological Process GO:0032008 positive regulation of TOR signaling Biological Process GO:0032527 protein exit from endoplasmic reticulum Biological Process GO:0051028 mRNA transport Biological Process GO:0072659 protein localization to plasma membrane Biological Process GO:0090110 COPII-coated vesicle cargo loading Biological Process GO:0090114 COPII-coated vesicle budding Biological Process GO:1904263 positive regulation of TORC1 signaling Biological Process GO:0000776 kinetochore Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G30050 ath:AT3G01340 bta:512530 mmu:110379 rno:297522 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24817WD40_WDHD1_1st4-113 aaPF25171Beta-prop_WDR36-Utp21_1st5-241 aaPF24105Beta-prop_CAF1B_HIR16-46 aaPF25047Beta-prop_TEP1_2nd6-111 aaPF25168Beta-prop_WDR36-Utp21_2nd7-146 aaPF23381Beta-prop_IFT122_1st8-161 aaPF00400WD408-37 aaPF25175Beta-prop_WDR58-158 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G544790 | PF24817 | WD40_WDHD1_1st | 4 | 113 | 3e-22 | 79.9 |
| TkA03G544790 | PF25171 | Beta-prop_WDR36-Utp21_1st | 5 | 241 | 6.7e-05 | 23.2 |
| TkA03G544790 | PF24105 | Beta-prop_CAF1B_HIR1 | 6 | 46 | 2e-19 | 70.6 |
| TkA03G544790 | PF25047 | Beta-prop_TEP1_2nd | 6 | 111 | 1.1e-14 | 55.0 |
| TkA03G544790 | PF25168 | Beta-prop_WDR36-Utp21_2nd | 7 | 146 | 3.5e-07 | 30.5 |
| TkA03G544790 | PF23381 | Beta-prop_IFT122_1st | 8 | 161 | 2.1e-35 | 123.1 |
| TkA03G544790 | PF00400 | WD40 | 8 | 37 | 1.2e-34 | 118.0 |
| TkA03G544790 | PF25175 | Beta-prop_WDR5 | 8 | 158 | 1.1e-31 | 110.9 |
| TkA03G544790 | PF25173 | Beta-prop_WDR3_1st | 8 | 86 | 1.5e-26 | 93.9 |
| TkA03G544790 | PF25172 | Beta-prop_WDR3_2nd | 8 | 89 | 1.7e-10 | 41.3 |
| TkA03G544790 | PF23869 | Beta-prop_WDR75_1st | 8 | 40 | 1.8e-06 | 28.2 |
| TkA03G544790 | PF24807 | WD40_CDC20-Fz | 9 | 160 | 2.8e-23 | 83.3 |
| TkA03G544790 | PF23411 | Beta-prop_Vps41 | 9 | 46 | 3.5e-11 | 43.7 |
| TkA03G544790 | PF12894 | ANAPC4_WD40 | 9 | 65 | 7.1e-10 | 39.7 |
| TkA03G544790 | PF24796 | WDR55 | 9 | 135 | 1.2e-09 | 38.3 |
| TkA03G544790 | PF25178 | Beta-prop_WDR41 | 9 | 124 | 4.1e-08 | 33.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.