TkA03G527550 | RubberDandelionOmics

Gene overview

TkA03G527550

Reference: TK1151 Chr: Chr03 Coordinates: 132569671-132571972 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1191 bp · TkA03G527550|TK1151|cDNA

GGCAGCTTTTCATACATGTTGCAGATCAAGACCCCGATCGGAGCAGCTCAAATGTTGGACTACGAATGGGGAAACCCGTCGACGATCATGCTCAACGGCACCGTCGCCGTCGACGAATCCACCTCCCACCCCGACCAAAACCGCCATATCTTCGAACAGTACTCACAAAGCTTCAACGAAACCACCGCTTCATCGTACCTCAACCCCAACGACTTCCTCCACCACACCCACAACCCCCACCACCACTATCTTAACAACCC...

CDS

Download CDS FASTA

897 bp · TkA03G527550|TK1151|CDS

ATGTTGCAGATCAAGACCCCGATCGGAGCAGCTCAAATGTTGGACTACGAATGGGGAAACCCGTCGACGATCATGCTCAACGGCACCGTCGCCGTCGACGAATCCACCTCCCACCCCGACCAAAACCGCCATATCTTCGAACAGTACTCACAAAGCTTCAACGAAACCACCGCTTCATCGTACCTCAACCCCAACGACTTCCTCCACCACACCCACAACCCCCACCACCACTATCTTAACAACCCCACCCAAACACATCC...

Protein

Download Protein FASTA

298 aa · TkA03G527550|TK1151|PROTEIN

MLQIKTPIGAAQMLDYEWGNPSTIMLNGTVAVDESTSHPDQNRHIFEQYSQSFNETTASSYLNPNDFLHHTHNPHHHYLNNPTQTHPHFASLYDPRAYGGNCAYPPSPTPLLSLEPEGSGNVNSHGQNGYMNNMIMPKPEPSGCAIDFTNNRIGLNLGGRTYFSSAEDDFVNRLYRRSRPLEAALVSSPRCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVITAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G527550`
TK1151 ID	TkA03G527550
OH-1004 ID	LXL04_026898
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	46.200
Protein coverage (%)	TK1151 87.248 / OH-1004 97.701 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G527550

Location Chr03:132569671-132571972 (+)

Description Similar to SPL8: Squamosa promoter-binding-like protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02065`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	SPL8, an SBP-box gene that affects pollen sac development in Arabidopsis.2003 · DOI: 10.1105/tpc.010678 Functional dissection of the plant-specific SBP-domain: overlap of the DNA-binding and nuclear localization domains.2005 · DOI: 10.1016/j.jmb.2005.07.013 SPL8, a local regulator in a subset of gibberellin-mediated developmental processes in Arabidopsis.2007 · DOI: 10.1007/s11103-006-9099-6

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YFT9`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release
`Os06g0659100`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release
`Os02g0177300`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release
`UniProt: Q01KM7`	Probable transcription factor that plays an important role in building the laminar joint between leaf blade and leaf sheath boundary, thereby controlling ligule and auricle development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026898 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009554 megasporogenesis Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048653 anther development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G02065

ath:AT1G20980

dosa:Os04g0656500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.923

Rank 1 · TkA03G527550 · TK1151

Cytoplasm0.156

Rank 2 · TkA03G527550 · TK1151

Cell membrane0.026

Rank 3 · TkA03G527550 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA03G527550 · TK1151

Plastid0.012

Rank 5 · TkA03G527550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03110SBP191-264 aa

PF21656DUF6859234-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G527550	`PF03110`	SBP	191	264	1.5e-31	109.2
TkA03G527550	`PF21656`	DUF6859	234	292	0.083	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXL3`	Arabidopsis thaliana	sp\|Q8GXL3\|SPL8_ARATH Squamosa promoter-binding-like protein 8	49.000%	Swiss-Prot	Medium
`A2YFT9`	Oryza sativa subsp. indica	sp\|A2YFT9\|SPL10_ORYSI Squamosa promoter-binding-like protein 10	60.800%	Swiss-Prot	Low
`Q0DAE8`	Oryza sativa subsp. japonica	sp\|Q0DAE8\|SPL10_ORYSJ Squamosa promoter-binding-like protein 10	60.800%	Swiss-Prot	Low
`Q0E3F8`	Oryza sativa subsp. japonica	sp\|Q0E3F8\|SPL5_ORYSJ Squamosa promoter-binding-like protein 5	57.800%	Swiss-Prot	Low
`Q01KM7`	Oryza sativa subsp. indica	sp\|Q01KM7\|SPL8_ORYSI Squamosa promoter-binding-like protein 8	62.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card