TkA03G518380 | RubberDandelionOmics

Gene overview

TkA03G518380

Reference: TK1151 Chr: Chr03 Coordinates: 130065378-130086759 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

960 bp · TkA03G518380|TK1151|cDNA

ATGTGGGTTCTTTGGCTTCACATAAATGAGTTGAGTTTCAAAGGCCAGGTCAAAGGTGTGGCTCAGTTAGCCAGTGAAACCAGCGCTTTTAATCGTCCCGATCCCATCGATATAAAGTATCTAACTACTAATCCACCAAAAACCATGGGAAGTATTTCTGAAGTTGTCTCCAGGTTGACAAACAAAATCGCACTCATCACCGGTGGAGCTCAAGGCATCGGCGAGGCAACAGCCAGGCTCTTCGTCAAACACGGAGCCAA...

CDS

Download CDS FASTA

960 bp · TkA03G518380|TK1151|CDS

ATGTGGGTTCTTTGGCTTCACATAAATGAGTTGAGTTTCAAAGGCCAGGTCAAAGGTGTGGCTCAGTTAGCCAGTGAAACCAGCGCTTTTAATCGTCCCGATCCCATCGATATAAAGTATCTAACTACTAATCCACCAAAAACCATGGGAAGTATTTCTGAAGTTGTCTCCAGGTTGACAAACAAAATCGCACTCATCACCGGTGGAGCTCAAGGCATCGGCGAGGCAACAGCCAGGCTCTTCGTCAAACACGGAGCCAA...

Protein

Download Protein FASTA

319 aa · TkA03G518380|TK1151|PROTEIN

MWVLWLHINELSFKGQVKGVAQLASETSAFNRPDPIDIKYLTTNPPKTMGSISEVVSRLTNKIALITGGAQGIGEATARLFVKHGAKVVIVDIQDELGQAVCEDIGLNNATYIHCDVTIESDVENAINLTLSKYGKLDIMVNNAAILDDGKPNIIDNDQLTFERVMSVNVTGVFLGTKHAARAMIPARKGSIIMMGSVSGSIGGIISHAYSSSKHAIVGLTKNTAAELGQYGIRVNCVSPYFIPSPLTADYTNDYPEKYA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G518380`
TK1151 ID	TkA03G518380
OH-1004 ID	LXL04_010308
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 91.850 / OH-1004 94.516 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G518380`
Location	Chr03:130065378-130086759 (-)
Description	Similar to Secoisolariciresinol dehydrogenase (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010308` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009688 abscisic acid biosynthetic process Biological Process GO:0009807 lignan biosynthetic process Biological Process GO:0016099 monoterpenoid biosynthetic process Biological Process GO:0016114 terpenoid biosynthetic process Biological Process GO:0044283 small molecule biosynthetic process Biological Process GO:0046211 (+)-camphor biosynthetic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0004022 alcohol dehydrogenase (NAD+) activity Molecular Function GO:0010301 xanthoxin dehydrogenase (NAD+) activity Molecular Function GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function GO:0047500 (+)-borneol dehydrogenase activity Molecular Function
KEGG gene cross-reference	ag:BAK09296 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.630

Rank 1 · TkA03G518380 · TK1151

Nucleus0.280

Rank 2 · TkA03G518380 · TK1151

Peroxisome0.163

Rank 3 · TkA03G518380 · TK1151

Mitochondrion0.087

Rank 4 · TkA03G518380 · TK1151

Plastid0.068

Rank 5 · TkA03G518380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short62-254 aa

PF01370Epimerase64-145 aa

PF08659KR65-220 aa

PF010733Beta_HSD65-128 aa

PF027373HCDH_N69-110 aa

PF13561adh_short_C270-303 aa

PF01370Epimerase200-227 aa

PF010733Beta_HSD249-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G518380	`PF00106`	adh_short	62	254	4.8e-54	183.5
TkA03G518380	`PF01370`	Epimerase	64	145	0.0058	16.8
TkA03G518380	`PF08659`	KR	65	220	4.3e-10	40.5
TkA03G518380	`PF01073`	3Beta_HSD	65	128	0.026	14.3
TkA03G518380	`PF02737`	3HCDH_N	69	110	0.15	12.7
TkA03G518380	`PF13561`	adh_short_C2	70	303	1.6e-62	211.9
TkA03G518380	`PF01370`	Epimerase	200	227	0.0058	16.8
TkA03G518380	`PF01073`	3Beta_HSD	249	269	0.026	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card