RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G355450
Reference: TK1151 Chr: Chr03 Coordinates: 87680287-87680761 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

372 bp · TkA03G355450|TK1151|cDNA

ATGAATACTCTTATGGCTTCGAAAGCGACTATTCTAGTCATAGTGGATTTGTTGAAAATGGCTCCATGTTTAGTTCTAAATCAAACGTGGACGTATCAAATTCCTGGTATAATGAGATGGAGATGTAGTAATCATGATATGGAGAGTAATCTACAAAATGTGATAGAAGAAGATGACTTGATATTAGATGCATCCTATATAGCTTCTCTCTGGGAGACATTCTTTCCAGAAGAACCGTATGGTGATGACTATAGGGCTAC...

CDS

Download CDS FASTA

372 bp · TkA03G355450|TK1151|CDS

ATGAATACTCTTATGGCTTCGAAAGCGACTATTCTAGTCATAGTGGATTTGTTGAAAATGGCTCCATGTTTAGTTCTAAATCAAACGTGGACGTATCAAATTCCTGGTATAATGAGATGGAGATGTAGTAATCATGATATGGAGAGTAATCTACAAAATGTGATAGAAGAAGATGACTTGATATTAGATGCATCCTATATAGCTTCTCTCTGGGAGACATTCTTTCCAGAAGAACCGTATGGTGATGACTATAGGGCTAC...

Protein

Download Protein FASTA

123 aa · TkA03G355450|TK1151|PROTEIN

MNTLMASKATILVIVDLLKMAPCLVLNQTWTYQIPGIMRWRCSNHDMESNLQNVIEEDDLILDASYIASLWETFFPEEPYGDDYRATSDNLPPYQDVNTQIFQIWSYLIQFTNKDHVNQQACV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G355450
TK1151 IDTkA03G355450
OH-1004 IDLXL04_035287
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 43.902 / OH-1004 14.173
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G355450
LocationChr03:87680287-87680761 (-)
DescriptionSimilar to ARR12: Two-component response regulator ARR12
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035287 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process
GO:0000160 phosphorelay signal transduction system Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0007623 circadian rhythm Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009735 response to cytokinin Biological Process
GO:0009736 cytokinin-activated signaling pathway Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0010082 regulation of root meristem growth Biological Process
GO:0010380 regulation of chlorophyll biosynthetic process Biological Process
GO:0010468 regulation of gene expression Biological Process
KEGG gene cross-reference
ath:AT2G25180
ath:AT3G16857
ath:AT3G46640
ath:AT5G59570
dosa:Os02g0182100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.393
Rank 1 · TkA03G355450 · TK1151
Cytoplasm0.360
Rank 2 · TkA03G355450 · TK1151
Mitochondrion0.180
Rank 3 · TkA03G355450 · TK1151
Cell membrane0.113
Rank 4 · TkA03G355450 · TK1151
Endoplasmic reticulum0.112
Rank 5 · TkA03G355450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser