Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1543 bp · TkA03G146740|TK1151|cDNA
AAAAAAGCGCGTTATTTCCACTCGCCCCCTTTAATACTTTCCTATAAATAACCACTGCAAATTTCCCATCAAAAACCCTCTCTCACGCACACTTCCATAGTCAAAATTACAATGGCAACCGGCACCGACAGATCTCAATCTACCACCACCGCCAATGGCGTCGAAGGACTAACAATATCCAAACGCAAGGTAGCTCTGATAACCGGAATTACAGGCCAAGACGGCTCTTACCTCACCGAACTCCTCCTCGAAAAAGGATA...
1113 bp · TkA03G146740|TK1151|CDS
ATGGCAACCGGCACCGACAGATCTCAATCTACCACCACCGCCAATGGCGTCGAAGGACTAACAATATCCAAACGCAAGGTAGCTCTGATAACCGGAATTACAGGCCAAGACGGCTCTTACCTCACCGAACTCCTCCTCGAAAAAGGATATGAAGTCCACGGTCTGATCCGCCGGTCTTCAAACTTCAACACCCAGCGGATCAACCACATCTACATCGACCCTCACAACACTCACAAGGCGCGAATGAAGCTCCACTACGC...
Protein
Download Protein FASTA370 aa · TkA03G146740|TK1151|PROTEIN
MATGTDRSQSTTTANGVEGLTISKRKVALITGITGQDGSYLTELLLEKGYEVHGLIRRSSNFNTQRINHIYIDPHNTHKARMKLHYADLTDASSLRRWIDTISPDEIYNLAAQSHVAVSFEIPDYTADVVATGSLRLLEALRSHITTTGRSCRYYQAGSSEMFGSTPPPQSEDTPFHPRSPYAASKCAAHWYTVNYREAYGIYACNGILFNHESPRRGENFVTRKITRAVGRIKVGLQNKLFLGNLQASRDWGFAGDYVE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G146740 |
|---|---|
| TK1151 ID | TkA03G146740 |
| OH-1004 ID | LXL04_012622 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 24.000 |
| Protein coverage (%) | TK1151 87.297 / OH-1004 69.336Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G146740 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:37400154-37401888 (-) | |||||||||
| Description | Similar to UXS1: UDP-glucuronic acid decarboxylase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0019305 dTDP-rhamnose biosynthetic process Biological Process GO:0033320 UDP-D-xylose biosynthetic process Biological Process GO:0042732 D-xylose metabolic process Biological Process GO:0045492 xylan biosynthetic process Biological Process GO:0000138 Golgi trans cisterna Cellular Component GO:0000139 Golgi membrane Cellular Component GO:0000325 plant-type vacuole Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005768 endosome Cellular Component GO:0005773 vacuole Cellular Component GO:0005777 peroxisome Cellular Component GO:0005794 Golgi apparatus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G28760 ath:AT2G47650 ath:AT3G46440 ath:AT3G53520 ath:AT3G62830 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05368NmrA26-59 aaPF00106adh_short26-102 aaPF01370Epimerase28-277 aaPF08659KR28-117 aaPF16363GDP_Man_Dehyd29-344 aaPF04321RmlD_sub_bind29-205 aaPF02719Polysacc_synt_229-124 aaPF13460NAD_binding_1032-79 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G146740 | PF05368 | NmrA | 26 | 59 | 0.069 | 13.4 |
| TkA03G146740 | PF00106 | adh_short | 26 | 102 | 0.22 | 11.7 |
| TkA03G146740 | PF01370 | Epimerase | 28 | 277 | 2.3e-73 | 247.3 |
| TkA03G146740 | PF08659 | KR | 28 | 117 | 0.15 | 12.7 |
| TkA03G146740 | PF16363 | GDP_Man_Dehyd | 29 | 344 | 3e-142 | 474.7 |
| TkA03G146740 | PF04321 | RmlD_sub_bind | 29 | 205 | 1.7e-06 | 28.1 |
| TkA03G146740 | PF02719 | Polysacc_synt_2 | 29 | 124 | 0.00018 | 21.5 |
| TkA03G146740 | PF13460 | NAD_binding_10 | 32 | 79 | 0.18 | 12.4 |
| TkA03G146740 | PF00106 | adh_short | 175 | 200 | 0.22 | 11.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.