RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G055660
Reference: TK1151 Chr: Chr03 Coordinates: 14377948-14379321 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1290 bp · TkA03G055660|TK1151|cDNA

ATGTTTGTGGAAATGCCTGTGTTTTCGACGAGGAGATGTGGGGCTGGCGGGCAGGTTTTAGATCTAGAGACTGCTGTAAGAGATGGAGTGTTGGGCGGCGGCGGTGGTGGAGGAGTTGGTTTCGGCGGTGGGTTTTCTGAGAAACTGGATCTGAGAAAGATGATTGGAGAGTTGGATTTGCCGGAGATTCCGTCGGTGTTCATTTGCCCGATTTCACTTGAACCGATGGAAGACCCAGTCACCCTGTGCACCGGCCAAAC...

CDS

Download CDS FASTA

1290 bp · TkA03G055660|TK1151|CDS

ATGTTTGTGGAAATGCCTGTGTTTTCGACGAGGAGATGTGGGGCTGGCGGGCAGGTTTTAGATCTAGAGACTGCTGTAAGAGATGGAGTGTTGGGCGGCGGCGGTGGTGGAGGAGTTGGTTTCGGCGGTGGGTTTTCTGAGAAACTGGATCTGAGAAAGATGATTGGAGAGTTGGATTTGCCGGAGATTCCGTCGGTGTTCATTTGCCCGATTTCACTTGAACCGATGGAAGACCCAGTCACCCTGTGCACCGGCCAAAC...

Protein

Download Protein FASTA

429 aa · TkA03G055660|TK1151|PROTEIN

MFVEMPVFSTRRCGAGGQVLDLETAVRDGVLGGGGGGGVGFGGGFSEKLDLRKMIGELDLPEIPSVFICPISLEPMEDPVTLCTGQTYERSNILKWFAIGHFTCPTTMQELWDDSVTPNNTLHRLIHTWFSQKYFQKKKKSEDVQGLTSEILDTLKQIKGQARIQSLKELRQVVTAHVIARKTVVDKGGVSLLSSLLGPYTSHAIGSEVISILVHLNLDSSSKSNLTQPAKISLMVDMLNEGSIETKINCTQLLKLLIGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G055660
TK1151 IDTkA03G055660
OH-1004 IDLXL04_006664
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G055660
LocationChr03:14377948-14379321 (-)
DescriptionSimilar to PUB31: U-box domain-containing protein 31
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g49810 Functions as an E3 ubiquitin ligase. No verified direct reference in this release
At5g65920 Functions as an E3 ubiquitin ligase. No verified direct reference in this release
At2g35930 E3 ubiquitin-protein ligase that negatively regulates water stress response.
Arabidopsis PUB22 and PUB23 are homologous U-Box E3 ubiquitin ligases that play combinatory roles in response to drought stress.2008 · DOI: 10.1105/tpc.108.060699
Negative regulation of PAMP-triggered immunity by an E3 ubiquitin ligase triplet in Arabidopsis.2008 · DOI: 10.1016/j.cub.2008.07.085
At3g19380 Functions as an E3 ubiquitin ligase. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0232600 E3 ubiquitin ligase that may function as positive regulator of brassinosteroid (BR) signaling.
The U-box E3 ubiquitin ligase TUD1 functions with a heterotrimeric G α subunit to regulate Brassinosteroid-mediated growth in rice.2013 · DOI: 10.1371/journal.pgen.1003391
An E3 ubiquitin ligase, ERECT LEAF1, functions in brassinosteroid signaling of rice.2013 · DOI: 10.4161/psb.27117
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006664 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002679 respiratory burst involved in defense response Biological Process
GO:0006952 defense response Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0051865 protein autoubiquitination Biological Process
GO:0071472 cellular response to salt stress Biological Process
GO:0098542 defense response to other organism Biological Process
GO:1900457 regulation of brassinosteroid mediated signaling pathway Biological Process
GO:1901001 negative regulation of response to salt stress Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT2G35930
ath:AT3G19380
ath:AT3G49810
ath:AT5G65920
dosa:Os03g0232600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.560
Rank 1 · TkA03G055660 · TK1151
Cytoplasm0.469
Rank 2 · TkA03G055660 · TK1151
Cell membrane0.068
Rank 3 · TkA03G055660 · TK1151
Endoplasmic reticulum0.040
Rank 4 · TkA03G055660 · TK1151
Mitochondrion0.033
Rank 5 · TkA03G055660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04564U-box63-133 aa
PF11789zf-Nse68-106 aa
PF15906zf-NOSIP68-96 aa
PF13445zf-RING_UBOX69-105 aa
PF25598ARM_PUB150-371 aa
PF00514Arm181-198 aa
PF00514Arm204-216 aa
PF00514Arm235-251 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G055660PF04564U-box631334.3e-1556.3
TkA03G055660PF11789zf-Nse681060.000620.3
TkA03G055660PF15906zf-NOSIP68960.1912.5
TkA03G055660PF13445zf-RING_UBOX691050.01516.0
TkA03G055660PF25598ARM_PUB1503711.3e-55189.7
TkA03G055660PF00514Arm1811982.98.8
TkA03G055660PF00514Arm2042162.98.8
TkA03G055660PF00514Arm2352512.98.8
TkA03G055660PF00514Arm2783022.98.8
TkA03G055660PF00514Arm3173332.98.8
TkA03G055660PF25598ARM_PUB3774281.3e-55189.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q058P4Arabidopsis thalianasp|Q058P4|PUB30_ARATH U-box domain-containing protein 3061.000%Swiss-ProtHigh
Q9FHN9Arabidopsis thalianasp|Q9FHN9|PUB31_ARATH U-box domain-containing protein 3159.700%Swiss-ProtHigh
Q84TG3Arabidopsis thalianasp|Q84TG3|PUB23_ARATH E3 ubiquitin-protein ligase PUB2325.700%Swiss-ProtLow
Q9LT79Arabidopsis thalianasp|Q9LT79|PUB25_ARATH U-box domain-containing protein 2527.300%Swiss-ProtLow
Q10PI9Oryza sativa subsp. japonicasp|Q10PI9|PUB75_ORYSJ U-box domain-containing protein 7548.700%Swiss-ProtMedium

JBrowse

View in Genome Browser