TkA03G028980 | RubberDandelionOmics

Gene overview

TkA03G028980

Reference: TK1151 Chr: Chr03 Coordinates: 7780316-7780768 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

453 bp · TkA03G028980|TK1151|cDNA

ATGTCTCCCAAATCCCCAAAACCAAACACGATCAACAGACAATTACAAGATTTCAGATGGGTTTTCGCTCGTTTTGACACCGACAACGACGGAAAGATTTCAGCTTTGGAGCTCCGATCATACTTCGGGTCCATTGGAGAGTACATGTCGCACCAGGAAGCTCAGTGTGTGATCGACGATTTGGATGTCGATGGTGACGGGTTTATTGATTTTGAGGATTTTATGCGGCTGATGAAGGTGAAGGATGAGGGGGATGATGT...

CDS

Download CDS FASTA

453 bp · TkA03G028980|TK1151|CDS

ATGTCTCCCAAATCCCCAAAACCAAACACGATCAACAGACAATTACAAGATTTCAGATGGGTTTTCGCTCGTTTTGACACCGACAACGACGGAAAGATTTCAGCTTTGGAGCTCCGATCATACTTCGGGTCCATTGGAGAGTACATGTCGCACCAGGAAGCTCAGTGTGTGATCGACGATTTGGATGTCGATGGTGACGGGTTTATTGATTTTGAGGATTTTATGCGGCTGATGAAGGTGAAGGATGAGGGGGATGATGT...

Protein

Download Protein FASTA

150 aa · TkA03G028980|TK1151|PROTEIN

MSPKSPKPNTINRQLQDFRWVFARFDTDNDGKISALELRSYFGSIGEYMSHQEAQCVIDDLDVDGDGFIDFEDFMRLMKVKDEGDDVKAAFEMFEHEKGCGQISPKSLQKTLSRLGESKSYDECLKMIKVFDVHGKGGVDFNEFQQMMMT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G028980`
TK1151 ID	TkA03G028980
OH-1004 ID	LXL04_006389
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 78.125 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G028980

Location Chr03:7780316-7780768 (+)

Description Similar to CML41: Probable calcium-binding protein CML41

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50770`	Potential calcium sensor.	No verified direct reference in this release
`At5g42380`	Potential calcium sensor that binds calcium in vitro.	Developmental and stimulus-induced expression patterns of Arabidopsis calmodulin-like genes CML37, CML38 and CML39.2007 · DOI: 10.1007/s11103-007-9189-0

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0134400`	Potential calcium sensor.	No verified direct reference in this release
`Os12g0132300`	Potential calcium sensor.	No verified direct reference in this release
`Os07g0618800`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006389 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0009611 response to wounding Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0071731 response to nitric oxide Biological Process

GO:0080164 regulation of nitric oxide metabolic process Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G18210

ath:AT1G66400

ath:AT1G76650

ath:AT3G50770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600

Rank 1 · TkA03G028980 · TK1151

Nucleus0.320

Rank 2 · TkA03G028980 · TK1151

Mitochondrion0.077

Rank 3 · TkA03G028980 · TK1151

Cell membrane0.070

Rank 4 · TkA03G028980 · TK1151

Endoplasmic reticulum0.067

Rank 5 · TkA03G028980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21008AIF-17-82 aa

PF10591SPARC_Ca_bdg12-75 aa

PF13833EF-hand_816-37 aa

PF30551CFAP251_C16-61 aa

PF13499EF-hand_717-79 aa

PF00036EF-hand_117-42 aa

PF23564EF-hand_FSTL120-78 aa

PF30624EF_SSP12020-75 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G028980	`PF21008`	AIF-1	7	82	7.5e-10	39.9
TkA03G028980	`PF10591`	SPARC_Ca_bdg	12	75	0.12	13.4
TkA03G028980	`PF13833`	EF-hand_8	16	37	4.1e-14	52.8
TkA03G028980	`PF30551`	CFAP251_C	16	61	0.00089	19.7
TkA03G028980	`PF13499`	EF-hand_7	17	79	5.2e-22	78.7
TkA03G028980	`PF00036`	EF-hand_1	17	42	6.3e-20	69.9
TkA03G028980	`PF23564`	EF-hand_FSTL1	20	78	0.003	18.7
TkA03G028980	`PF30624`	EF_SSP120	20	75	0.084	14.3
TkA03G028980	`PF13405`	EF-hand_6	21	46	5.1e-19	66.9
TkA03G028980	`PF13202`	EF-hand_5	21	40	6.7e-14	51.3
TkA03G028980	`PF14658`	EF-hand_9	22	79	0.00047	21.3
TkA03G028980	`PF00404`	Dockerin_1	24	38	0.00011	23.0
TkA03G028980	`PF29176`	Allatotropin-like_C	26	38	0.0065	16.8
TkA03G028980	`PF13833`	EF-hand_8	46	79	4.1e-14	52.8
TkA03G028980	`PF00036`	EF-hand_1	55	79	6.3e-20	69.9
TkA03G028980	`PF23564`	EF-hand_FSTL1	55	84	0.003	18.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L3R2`	Arabidopsis thaliana	sp\|Q8L3R2\|CML41_ARATH Probable calcium-binding protein CML41	49.100%	Swiss-Prot	Medium
`Q9FIH9`	Arabidopsis thaliana	sp\|Q9FIH9\|CML37_ARATH Calcium-binding protein CML37	42.100%	Swiss-Prot	Medium
`Q0IUU4`	Oryza sativa subsp. japonica	sp\|Q0IUU4\|CML2_ORYSJ Putative calmodulin-like protein 2	36.200%	Swiss-Prot	Medium
`Q0IQB6`	Oryza sativa subsp. japonica	sp\|Q0IQB6\|CML3_ORYSJ Calmodulin-like protein 3	35.500%	Swiss-Prot	Medium
`Q7F0J0`	Oryza sativa subsp. japonica	sp\|Q7F0J0\|CML13_ORYSJ Probable calcium-binding protein CML13	34.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card