TkA02G407240 | RubberDandelionOmics

Gene overview

TkA02G407240

Reference: TK1151 Chr: Chr02 Coordinates: 103564552-103566025 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1163 bp · TkA02G407240|TK1151|cDNA

GGAAAAAGTCGTGGATGGTTGTAGTGGTGGGATCAAACGAATACTTATAGCGGACATTCCCATCCCAAAACTATTTAACTACAATACCAGCCACACAATCAGTGAATCAGCTCATCTAGATCCTCAATCGCAGTTGCAATATCTTCAATTCAACTATCCATGGCGTCTCCCCTGATTCACTCCTCAATTTCACCCTCCAACGCTCGCCTGCAATCTTCTTTTCCGAAACTAAACAAGGTCGTTGGTTTCAATTATACCCA...

CDS

Download CDS FASTA

843 bp · TkA02G407240|TK1151|CDS

ATGGCGTCTCCCCTGATTCACTCCTCAATTTCACCCTCCAACGCTCGCCTGCAATCTTCTTTTCCGAAACTAAACAAGGTCGTTGGTTTCAATTATACCCATAGACTACCCAAGAGAAAATTACCTTTCATTACCTTAGCCACCGTCGACGAAAAAGTTCCCTCTTCCGACCCATCTTCATCGTCGTTTTCCGGGTTTGATCTTCCCGAGATTCCTGATTTGACCAAGGGCGATACACTCAAGTCCTTGAAGCTTAAATT...

Protein

Download Protein FASTA

280 aa · TkA02G407240|TK1151|PROTEIN

MASPLIHSSISPSNARLQSSFPKLNKVVGFNYTHRLPKRKLPFITLATVDEKVPSSDPSSSSFSGFDLPEIPDLTKGDTLKSLKLKLLSSISGLNRGLVASDEDIKKADSAAREIEAAGGPVDLTTDLDKLQGRWKLIYSSAFSSKTLGGSRPGPPVGRLLPITLGQVFQRIDTVSKDFDNVVELQLGAPWPLEPVEVTATLAHRFEIIGSSKIKIIFEKTTVKTTGSLSQLPRFEVPQLPEQFRPSTNRGSGDFEVTYL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G407240`
TK1151 ID	TkA02G407240
OH-1004 ID	LXL04_014628
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G407240

Location Chr02:103564552-103566025 (+)

Description Similar to PAP6: Plastid-lipid-associated protein 6, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23400`	Required for plastoglobule development and resistance to multiple stresses.	FIBRILLIN4 is required for plastoglobule development and stress resistance in apple and Arabidopsis.2010 · DOI: 10.1104/pp.110.164095
`At3g26070`	Probable plastid-lipid-associated protein 4, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0133600`	Probable plastid-lipid-associated protein 2, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014628 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0010193 response to ozone Biological Process

GO:0010236 plastoquinone biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT3G23400

ath:AT5G09820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.989

Rank 1 · TkA02G407240 · TK1151

Mitochondrion0.021

Rank 2 · TkA02G407240 · TK1151

Cytoplasm0.016

Rank 3 · TkA02G407240 · TK1151

Nucleus0.014

Rank 4 · TkA02G407240 · TK1151

Peroxisome0.011

Rank 5 · TkA02G407240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04755PAP_fibrillin82-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G407240	`PF04755`	PAP_fibrillin	82	277	5.6e-45	154.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW57`	Arabidopsis thaliana	sp\|Q9LW57\|PAP6_ARATH Plastid-lipid-associated protein 6, chloroplastic	71.200%	Swiss-Prot	High
`Q9LU85`	Arabidopsis thaliana	sp\|Q9LU85\|PAP4_ARATH Probable plastid-lipid-associated protein 4, chloroplastic	27.800%	Swiss-Prot	Low
`Q6K439`	Oryza sativa subsp. japonica	sp\|Q6K439\|PAP2_ORYSJ Probable plastid-lipid-associated protein 2, chloroplastic	23.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card