Gene Card
Gene overview
cDNA / CDS / Protein Sequences
939 bp · TkA02G370010|TK1151|cDNA
ATGGGCGAACTCCCACCGCCATCGCAGCTTCACCCTTCTCAACCTCCATCACTTCGACAGCCCATCTCTGCAGTATCTAATCATCAACCGGAATTCTGGTGTTACCAACTGCAACCGCAGCTTCGTCGAGTCCATCTCCGCCCTCCTCCACATCTCCGAGACCTAATGGATGACGAAATTCCACCTCTCAGCAATTCTCCTGATGACGATGGCGATTTGCCCCTTCCGGACGCCACAGCCGATGGCACCGTTCATCTCCG...
939 bp · TkA02G370010|TK1151|CDS
ATGGGCGAACTCCCACCGCCATCGCAGCTTCACCCTTCTCAACCTCCATCACTTCGACAGCCCATCTCTGCAGTATCTAATCATCAACCGGAATTCTGGTGTTACCAACTGCAACCGCAGCTTCGTCGAGTCCATCTCCGCCCTCCTCCACATCTCCGAGACCTAATGGATGACGAAATTCCACCTCTCAGCAATTCTCCTGATGACGATGGCGATTTGCCCCTTCCGGACGCCACAGCCGATGGCACCGTTCATCTCCG...
Protein
Download Protein FASTA312 aa · TkA02G370010|TK1151|PROTEIN
MGELPPPSQLHPSQPPSLRQPISAVSNHQPEFWCYQLQPQLRRVHLRPPPHLRDLMDDEIPPLSNSPDDDGDLPLPDATADGTVHLRRELEESDDNHHEYDVVESLNQGNRDRQGSDDENEEGEERQRQRRHLLRLRLQDHGLSAGRHGRILDWAELLLQLEDQSVTFGQQRLEFEDGYIGNPGDYVDATGYDSFLQTLAESGSNDRRGAPPASKSAVQALQTVEVNEMTTESCAVCKEGMFNNEQMIVKQLPCGHMYHS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G370010 |
|---|---|
| TK1151 ID | TkA02G370010 |
| OH-1004 ID | LXL04_015086 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 92.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G370010 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:94174716-94175743 (+) | |||||||||
| Description | Similar to CIP8: E3 ubiquitin-protein ligase CIP8 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0016567 protein ubiquitination Biological Process GO:0090378 seed trichome elongation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G19950 ath:AT5G64920 dosa:Os05g0488800 osa:4339152 xla:444028 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23412zf_RING_Vps825-36 aaPF29452FAR1_N26-36 aaPF11809DUF3330223-238 aaPF29452FAR1_N229-280 aaPF17120zf-RING_16230-274 aaPF12678zf-rbx1232-277 aaPF13920zf-C3HC4_3232-279 aaPF22908PHD_NSD232-271 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G370010 | PF23412 | zf_RING_Vps8 | 25 | 36 | 0.047 | 14.3 |
| TkA02G370010 | PF29452 | FAR1_N | 26 | 36 | 0.0046 | 17.7 |
| TkA02G370010 | PF11809 | DUF3330 | 223 | 238 | 0.58 | 11.0 |
| TkA02G370010 | PF29452 | FAR1_N | 229 | 280 | 0.0046 | 17.7 |
| TkA02G370010 | PF17120 | zf-RING_16 | 230 | 274 | 0.064 | 13.6 |
| TkA02G370010 | PF12678 | zf-rbx1 | 232 | 277 | 3.1e-09 | 37.6 |
| TkA02G370010 | PF13920 | zf-C3HC4_3 | 232 | 279 | 0.00024 | 21.6 |
| TkA02G370010 | PF22908 | PHD_NSD | 232 | 271 | 0.03 | 15.3 |
| TkA02G370010 | PF14446 | Prok-RING_1 | 232 | 263 | 0.5 | 11.3 |
| TkA02G370010 | PF13639 | zf-RING_2 | 233 | 277 | 3.8e-12 | 47.0 |
| TkA02G370010 | PF13923 | zf-C3HC4_2 | 234 | 276 | 1.4e-08 | 35.1 |
| TkA02G370010 | PF00097 | zf-C3HC4 | 234 | 276 | 5.8e-07 | 30.0 |
| TkA02G370010 | PF13445 | zf-RING_UBOX | 234 | 274 | 8.8e-06 | 26.3 |
| TkA02G370010 | PF17123 | zf-RING_11 | 234 | 263 | 0.00012 | 22.4 |
| TkA02G370010 | PF14447 | Prok-RING_4 | 234 | 285 | 0.00013 | 22.5 |
| TkA02G370010 | PF14634 | zf-RING_5 | 234 | 278 | 0.0015 | 19.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.