TkA02G198510 | RubberDandelionOmics

Gene overview

TkA02G198510

Reference: TK1151 Chr: Chr02 Coordinates: 50818134-50818769 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

330 bp · TkA02G198510|TK1151|cDNA

ATGCTTTTATCTGAGAGGCCCAAAGATATTGGCAACAGATGGACTGAAATTGCAAAACGTATAACTTCTTTAGTTTCATGTTTTTGTGCCTTCACTACAAAGGCTAAAATCCAAGTGGTAGCTTGGGAACCTACGGTATCAGCAACAATTATGATCCTAATGAGTATGTGGGAGCTATTATTATCCTTTGTTCTGAAAGAAGAAGAAAATTTGGTATTGAAATTTGTTGTTTGTAGTATACATTCAAAGGCGTTTGTGAA...

CDS

Download CDS FASTA

330 bp · TkA02G198510|TK1151|CDS

ATGCTTTTATCTGAGAGGCCCAAAGATATTGGCAACAGATGGACTGAAATTGCAAAACGTATAACTTCTTTAGTTTCATGTTTTTGTGCCTTCACTACAAAGGCTAAAATCCAAGTGGTAGCTTGGGAACCTACGGTATCAGCAACAATTATGATCCTAATGAGTATGTGGGAGCTATTATTATCCTTTGTTCTGAAAGAAGAAGAAAATTTGGTATTGAAATTTGTTGTTTGTAGTATACATTCAAAGGCGTTTGTGAA...

Protein

Download Protein FASTA

109 aa · TkA02G198510|TK1151|PROTEIN

MLLSERPKDIGNRWTEIAKRITSLVSCFCAFTTKAKIQVVAWEPTVSATIMILMSMWELLLSFVLKEEENLVLKFVVCSIHSKAFVKYHLPLRKLLCDFYNELKSITSG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G198510`
TK1151 ID	TkA02G198510
OH-1004 ID	LXL04_020641
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.700
Protein coverage (%)	TK1151 90.826 / OH-1004 39.759 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G198510

Location Chr02:50818134-50818769 (-)

Description Similar to MYB124: Transcription factor MYB124

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39900`	Promotes mitochondrial protein synthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8B2R1`	Promotes mitochondrial protein synthesis.	No verified direct reference in this release
`Os06g0144800`	Promotes mitochondrial protein synthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020641 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009554 megasporogenesis Biological Process

GO:0009629 response to gravity Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009960 endosperm development Biological Process

GO:0010052 guard cell differentiation Biological Process

KEGG gene cross-reference

ath:AT1G14350

ath:AT2G02820

ath:AT5G40360

hsa:4605

mmu:17865

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.364

Rank 1 · TkA02G198510 · TK1151

Cytoplasm0.231

Rank 2 · TkA02G198510 · TK1151

Nucleus0.184

Rank 3 · TkA02G198510 · TK1151

Endoplasmic reticulum0.101

Rank 4 · TkA02G198510 · TK1151

Cell membrane0.093

Rank 5 · TkA02G198510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00679EFG_C82-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G198510	`PF00679`	EFG_C	82	109	0.0044	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLE4`	Arabidopsis thaliana	sp\|Q9FLE4\|GUF1_ARATH Translation factor GUF1 homolog, mitochondrial	43.500%	Swiss-Prot	Medium
`B8B2R1`	Oryza sativa subsp. indica	sp\|B8B2R1\|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial	44.100%	Swiss-Prot	Medium
`Q5VQ69`	Oryza sativa subsp. japonica	sp\|Q5VQ69\|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial	43.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card