TkA01G546230 | RubberDandelionOmics

Gene overview

TkA01G546230

Reference: TK1151 Chr: Chr01 Coordinates: 137164073-137168269 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2030 bp · TkA01G546230|TK1151|cDNA

AAAACGGTAGGTTTAGTTGAAATGAAAACAAAATCTGACACCCTATTTGTCAGAAAACAAAGAAACGCAAAACTCTCTTTTATTTGTCTCCGTTGCAAGTGTGATAGTAGTATTCCACAACCTAAATCAAAAGATCAAAATTCCAAAAAACCCTCTCGCTATCTTTCAAGAAAATGCAGTAAACTGGTGGAGAGAGAAATCCCAATCAGATAATGGTAAAATAAAGAAGAAAACCAACACCCAAACGATAAACCAATCGG...

CDS

Download CDS FASTA

999 bp · TkA01G546230|TK1151|CDS

ATGGCTCTTTTGGTGTTGTTTTTTCAGGCAAAATGCAGAGAGACAGGAGAGATAGTGGCAATCAAGAAAGTACTTCAAGATAAGAGATACAAAAACAGGGAGTTACAGATAATGCAAATGCTTGATCATCCAAATGTGGTGGCACTAAAACATTCCTTCTTTTCAACAACTGAAAAAGATGAGCTGTACCTTAATCTTGTTCTTGATTTTGTTCCTGAAACTGTTAGCCGTACAGCAAGGCATTATACTAGGATGAATCA...

Protein

Download Protein FASTA

332 aa · TkA01G546230|TK1151|PROTEIN

MALLVLFFQAKCRETGEIVAIKKVLQDKRYKNRELQIMQMLDHPNVVALKHSFFSTTEKDELYLNLVLDFVPETVSRTARHYTRMNQRMPLIYVKLYTYQICRALAYIHNCIGICHRDIKPQNLLVNPHTHQLKLCDFGSAKVLVKGEPNVSYICSRYYRAPELIFGATEYTTAIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFRFPQIKPHPWHKVFQKRLPPEAVDLVCRFFQY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G546230`
TK1151 ID	TkA01G546230
OH-1004 ID	LXL04_001334
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 97.892 / OH-1004 76.112 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G546230

Location Chr01:137164073-137168269 (+)

Description Similar to ASK10: Shaggy-related protein kinase kappa

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g57870`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At1g09840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At5g14640`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At3g05840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001334 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006972 hyperosmotic response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009651 response to salt stress Biological Process

GO:0030154 cell differentiation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09840

ath:AT1G57870

ath:AT5G14640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.596

Rank 1 · TkA01G546230 · TK1151

Nucleus0.578

Rank 2 · TkA01G546230 · TK1151

Cell membrane0.051

Rank 3 · TkA01G546230 · TK1151

Mitochondrion0.049

Rank 4 · TkA01G546230 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA01G546230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase8-277 aa

PF07714PK_Tyr_Ser-Thr13-195 aa

PF06293Kdo33-138 aa

PF01633Choline_kinase74-139 aa

PF05445Pox_ser-thr_kin87-135 aa

PF03109ABC1108-143 aa

PF01636APH113-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G546230	`PF00069`	Pkinase	8	277	2.9e-55	188.2
TkA01G546230	`PF07714`	PK_Tyr_Ser-Thr	13	195	4.4e-19	69.5
TkA01G546230	`PF06293`	Kdo	33	138	0.16	12.1
TkA01G546230	`PF01633`	Choline_kinase	74	139	0.0022	18.1
TkA01G546230	`PF05445`	Pox_ser-thr_kin	87	135	0.098	12.3
TkA01G546230	`PF03109`	ABC1	108	143	0.12	12.2
TkA01G546230	`PF01636`	APH	113	138	0.23	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVS6`	Arabidopsis thaliana	sp\|Q9FVS6\|KSG4_ARATH Shaggy-related protein kinase delta	89.500%	Swiss-Prot	High
`Q39019`	Arabidopsis thaliana	sp\|Q39019\|KSG10_ARATH Shaggy-related protein kinase kappa	89.500%	Swiss-Prot	High
`Q8VZD5`	Arabidopsis thaliana	sp\|Q8VZD5\|KSG5_ARATH Shaggy-related protein kinase epsilon	84.200%	Swiss-Prot	High
`P43289`	Arabidopsis thaliana	sp\|P43289\|KSG3_ARATH Shaggy-related protein kinase gamma	82.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card