TkA01G533530 | RubberDandelionOmics

Gene overview

TkA01G533530

Reference: TK1151 Chr: Chr01 Coordinates: 133914288-133916532 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

911 bp · TkA01G533530|TK1151|cDNA

ATTTATGTAATATCACTTTGAAATTAATCATATTCATTCTCACCCTCAACAAACAATAATCAACATTCAAACGACTCTCTCGAATCCATTAGATTTTAATGAGATACACTCATCTATACGACAACTGATCCACCGGAGACAAAGATAACTAACACACCGGTATTTGATCGAAGGAGTACGGAATGATGAAGAGATTCGCCGTTTTCCAGTGTGTACAGGATACCGACTACGTGAAAAACAAATACGGAGGTTATTTTGGG...

CDS

Download CDS FASTA

729 bp · TkA01G533530|TK1151|CDS

ATGATGAAGAGATTCGCCGTTTTCCAGTGTGTACAGGATACCGACTACGTGAAAAACAAATACGGAGGTTATTTTGGGGTTTTCATGAGAATGTTGGCGGAGGAAGGGGAAAACTGGGACGTGTTCCATGTTGCCGATGGGGATTTTCCTGACGATAGAGAGATTCCAACTTATGATGGTTTCGTGATTACTGGTAGCCGCAAAGACGCATTTGGCGACGATTCTTGGATCTGTGAGCTTCTCACTTTGCTCAACAAGTT...

Protein

Download Protein FASTA

242 aa · TkA01G533530|TK1151|PROTEIN

MMKRFAVFQCVQDTDYVKNKYGGYFGVFMRMLAEEGENWDVFHVADGDFPDDREIPTYDGFVITGSRKDAFGDDSWICELLTLLNKLHLLEKKILGICFGHQILARVLGGKVARANSGADIGVRTINLSSSTQFFANLETPSTLSVIKCHQDEVYELPSNVELLAGSDKTRVEMFRYRHHIMGIQGHPEYTNDILINLVDCFLQMNMCQESYAMEIKAKLEIKQPDTVLWKELCTSFLKGRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G533530`
TK1151 ID	TkA01G533530
OH-1004 ID	LXL04_001464
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.700
Protein coverage (%)	TK1151 99.587 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G533530

Location Chr01:133914288-133916532 (+)

Description Similar to GGP3: Gamma-glutamyl peptidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30550`	Involved in glucosinolate biosynthesis.	Cytosolic γ-glutamyl peptidases process glutathione conjugates in the biosynthesis of glucosinolates and camalexin in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083998
`At2g23970`	Involved in glucosinolate biosynthesis.	No verified direct reference in this release
`At4g30530`	Involved in glucosinolate biosynthesis.	Cytosolic γ-glutamyl peptidases process glutathione conjugates in the biosynthesis of glucosinolates and camalexin in Arabidopsis.2011 · DOI: 10.1105/tpc.111.083998
`At4g30540`	Involved in glucosinolate biosynthesis.	No verified direct reference in this release
`At2g23960`	Involved in glucosinolate biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001464 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010120 camalexin biosynthetic process Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0008233 peptidase activity Molecular Function

GO:0034722 gamma-glutamyl-peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G23960

ath:AT2G23970

ath:AT4G30530

ath:AT4G30540

ath:AT4G30550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.734

Rank 1 · TkA01G533530 · TK1151

Nucleus0.440

Rank 2 · TkA01G533530 · TK1151

Mitochondrion0.077

Rank 3 · TkA01G533530 · TK1151

Cell membrane0.040

Rank 4 · TkA01G533530 · TK1151

Peroxisome0.039

Rank 5 · TkA01G533530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07685GATase_351-108 aa

PF04204HTS56-195 aa

PF00117GATase57-191 aa

PF07722Peptidase_C2657-67 aa

PF07722Peptidase_C2683-189 aa

PF00117GATase198-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G533530	`PF07685`	GATase_3	51	108	0.24	11.7
TkA01G533530	`PF04204`	HTS	56	195	0.00087	19.1
TkA01G533530	`PF00117`	GATase	57	191	5.1e-17	62.9
TkA01G533530	`PF07722`	Peptidase_C26	57	67	3.3e-06	27.8
TkA01G533530	`PF07722`	Peptidase_C26	83	189	3.3e-06	27.8
TkA01G533530	`PF00117`	GATase	198	227	5.1e-17	62.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0A5`	Arabidopsis thaliana	sp\|Q9M0A5\|GGP3_ARATH Gamma-glutamyl peptidase 3	50.000%	Swiss-Prot	High
`O82225`	Arabidopsis thaliana	sp\|O82225\|GGP5_ARATH Gamma-glutamyl peptidase 5	50.200%	Swiss-Prot	High
`Q9M0A7`	Arabidopsis thaliana	sp\|Q9M0A7\|GGP1_ARATH Gamma-glutamyl peptidase 1	44.300%	Swiss-Prot	Medium
`Q9M0A6`	Arabidopsis thaliana	sp\|Q9M0A6\|GGP2_ARATH Gamma-glutamyl peptidase 2	43.900%	Swiss-Prot	Medium
`F4INN2`	Arabidopsis thaliana	sp\|F4INN2\|GGP4_ARATH Gamma-glutamyl peptidase 4	43.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card